Comparing CCNA_00902 FitnessBrowser__Caulo:CCNA_00902 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
99% identity, 89% coverage: 35:325/326 of query aligns to 6:296/296 of 4irxA
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
41% identity, 88% coverage: 40:325/326 of query aligns to 7:290/291 of 4rxmA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
41% identity, 88% coverage: 40:325/326 of query aligns to 5:288/288 of 4rxmB
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
36% identity, 79% coverage: 40:298/326 of query aligns to 5:254/270 of 4zjpA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
36% identity, 72% coverage: 47:282/326 of query aligns to 10:239/274 of 2ioyA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
35% identity, 81% coverage: 47:310/326 of query aligns to 11:269/271 of 1dbpA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
32% identity, 85% coverage: 42:318/326 of query aligns to 13:281/284 of 7e7mC
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
29% identity, 85% coverage: 47:323/326 of query aligns to 11:290/292 of 2fn8A
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
34% identity, 80% coverage: 38:298/326 of query aligns to 2:267/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
34% identity, 80% coverage: 38:298/326 of query aligns to 2:267/288 of 1gudA
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
34% identity, 80% coverage: 38:298/326 of query aligns to 2:267/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
34% identity, 80% coverage: 38:298/326 of query aligns to 2:267/288 of 8wl9A
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
32% identity, 76% coverage: 47:295/326 of query aligns to 12:263/287 of 5dteB
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
28% identity, 84% coverage: 42:316/326 of query aligns to 7:287/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
28% identity, 84% coverage: 42:316/326 of query aligns to 7:287/297 of 4ry9A
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
30% identity, 67% coverage: 63:282/326 of query aligns to 27:249/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
30% identity, 67% coverage: 63:282/326 of query aligns to 27:249/304 of 6hbmA
Sites not aligning to the query:
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
30% identity, 67% coverage: 63:282/326 of query aligns to 28:250/305 of 6hbdA
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
27% identity, 85% coverage: 42:318/326 of query aligns to 11:282/287 of 4yo7A
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
26% identity, 68% coverage: 62:282/326 of query aligns to 25:247/302 of 5ocpA
Sites not aligning to the query:
>CCNA_00902 FitnessBrowser__Caulo:CCNA_00902
MIRPSMSRRRLLGLAAGLGLGTAALGLMTGCARGGAEAEVVVSFNDLSQPFFVAMRRELE
DEAAKLGVKVQVLDAQNNSSKQISDLQAAAVQGAKVVIVAPTDSKALAGAADDLVEQGVA
VISVDRNIAGGKTAVPHVGADNVAGGRAMADWVVKTYPAGARVVVITNDPGSSSSIERVK
GVHDGLAAGGPAFKIVTEQTANSKRDQALTVTQNILTSMRDTPPDVILCLNDDMAMGALE
AVRAAGLDSAKVKVIGFDAIPEALARIKAGEMVATVEQNPGLQIRTALRQAVDKIKSGAA
LKSVSLKPVLITSGNLTEASRIGEMK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory