SitesBLAST
Comparing CCNA_01001 CCNA_01001 ribokinase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
45% identity, 99% coverage: 3:303/303 of query aligns to 2:300/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N181), T217 (= T219), G219 (= G221), A220 (= A222), G222 (= G224), F250 (= F253), N272 (= N275), G275 (≠ A278), A276 (= A279), T279 (≠ V282)
- binding magnesium ion: D242 (= D245), T244 (≠ V247), A278 (≠ S281), S287 (= S290)
6znxC Ribokinase from thermus species
40% identity, 99% coverage: 3:303/303 of query aligns to 2:265/265 of 6znxC
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
37% identity, 99% coverage: 2:302/303 of query aligns to 3:303/305 of 1rk2A
- active site: A249 (≠ G248), A250 (= A249), G251 (= G250), D252 (= D251)
- binding adenosine-5'-diphosphate: T220 (= T219), G222 (= G221), S223 (≠ A222), A250 (= A249), G251 (= G250), H276 (≠ N275), A279 (= A278)
- binding tetrafluoroaluminate ion: G213 (≠ P212), R215 (≠ Q214)
- binding magnesium ion: D246 (= D245), A282 (≠ S281), R285 (≠ K284), S291 (= S290)
- binding alpha-D-ribofuranose: N11 (= N10), D13 (= D12), G38 (= G37), G39 (= G38), K40 (= K39), N43 (= N42), E140 (= E137), D252 (= D251)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
40% identity, 98% coverage: 5:301/303 of query aligns to 6:302/306 of 4xckA
- active site: A249 (≠ G248), A250 (= A249), G251 (= G250), D252 (= D251)
- binding adenosine-5'-diphosphate: T220 (= T219), G222 (= G221), S223 (≠ A222), V242 (= V241), T247 (= T246), A250 (= A249), F254 (= F253), H276 (≠ N275), A279 (= A278), V283 (= V282)
- binding alpha-D-ribofuranose: N11 (= N10), D13 (= D12), G39 (= G38), K40 (= K39), N43 (= N42), A95 (= A94), I107 (= I106), I109 (≠ V108), E140 (= E137), T248 (≠ V247), D252 (= D251)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 99% coverage: 2:302/303 of query aligns to 6:306/309 of P0A9J6
1gqtB Activation of ribokinase by monovalent cations (see paper)
37% identity, 99% coverage: 2:302/303 of query aligns to 5:305/307 of 1gqtB
- active site: A251 (≠ G248), A252 (= A249), G253 (= G250), D254 (= D251)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N181), T222 (= T219), G224 (= G221), S225 (≠ A222), A252 (= A249), G253 (= G250), H278 (≠ N275), A281 (= A278)
- binding cesium ion: D248 (= D245), I250 (≠ V247), A284 (≠ S281), R287 (≠ K284), S293 (= S290)
- binding alpha-D-ribofuranose: N13 (= N10), D15 (= D12), G41 (= G38), N45 (= N42), E142 (= E137), D254 (= D251)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
36% identity, 99% coverage: 3:302/303 of query aligns to 5:311/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N181), T222 (= T219), G224 (= G221), A225 (= A222), G227 (= G224), T243 (≠ G238), V246 (= V241), A254 (= A249), G255 (= G250), N282 (= N275), A285 (= A278), A286 (= A279), V289 (= V282)
- binding alpha-D-ribofuranose: D14 (= D12), G40 (= G38), K41 (= K39), N44 (= N42), A96 (= A94), E141 (= E137), D256 (= D251)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
36% identity, 99% coverage: 3:302/303 of query aligns to 5:311/317 of 5c41A
- active site: G253 (= G248), A254 (= A249), G255 (= G250), D256 (= D251)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N181), T222 (= T219), G224 (= G221), A225 (= A222), G227 (= G224), V246 (= V241), G255 (= G250), N282 (= N275), A285 (= A278), A286 (= A279)
6wjzA Crystal structure of human ribokinase in complex with ampcp
36% identity, 99% coverage: 3:302/303 of query aligns to 5:311/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N181), T222 (= T219), G224 (= G221), A225 (= A222), G227 (= G224), T243 (≠ G238), V246 (= V241), A254 (= A249), G255 (= G250), N282 (= N275), A285 (= A278), A286 (= A279), V289 (= V282)
5c3yA Structure of human ribokinase crystallized with amppnp
36% identity, 97% coverage: 3:297/303 of query aligns to 4:303/306 of 5c3yA
- active site: G252 (= G248), A253 (= A249), G254 (= G250), D255 (= D251)
- binding amp phosphoramidate: T221 (= T219), G223 (= G221), V245 (= V241), T250 (= T246), G254 (= G250), N281 (= N275), A284 (= A278), A285 (= A279)
2fv7A Crystal structure of human ribokinase
36% identity, 97% coverage: 3:297/303 of query aligns to 4:303/308 of 2fv7A
- active site: G252 (= G248), A253 (= A249), G254 (= G250), D255 (= D251)
- binding adenosine-5'-diphosphate: N185 (= N181), T221 (= T219), G223 (= G221), G226 (= G224), T242 (≠ G238), V245 (= V241), A253 (= A249), G254 (= G250), N281 (= N275), A284 (= A278), A285 (= A279), V288 (= V282)
5byfA Crystal structure of human ribokinase in complex with amp
36% identity, 98% coverage: 7:302/303 of query aligns to 10:312/313 of 5byfA
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
36% identity, 96% coverage: 7:297/303 of query aligns to 22:317/322 of Q9H477
6a8cA Ribokinase from leishmania donovani with adp (see paper)
35% identity, 98% coverage: 3:299/303 of query aligns to 16:324/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G221), A246 (= A222), T271 (= T246), A274 (= A249), G275 (= G250), N300 (= N275), A303 (= A278)
- binding glycerol: D25 (= D12), S42 (≠ G29), S44 (= S31), G50 (= G37), G51 (= G38), N55 (= N42)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
35% identity, 98% coverage: 3:299/303 of query aligns to 16:324/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G221), A246 (= A222), T271 (= T246), A274 (= A249), G275 (= G250), N300 (= N275), A303 (= A278), V307 (= V282)
- binding glycerol: D25 (= D12), G50 (= G37), G51 (= G38), N55 (= N42), N157 (≠ L136), I159 (≠ T138), E190 (vs. gap)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
35% identity, 98% coverage: 3:299/303 of query aligns to 16:324/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N181), T243 (= T219), G245 (= G221), A246 (= A222), G248 (= G224), T271 (= T246), G273 (= G248), A274 (= A249), G275 (= G250), N300 (= N275), A303 (= A278), V307 (= V282)
- binding glycerol: D25 (= D12), G50 (= G37), G51 (= G38), N55 (= N42)
P0DX97 Deoxyribokinase; dRK; ATP:2-deoxy-D-ribose 5-phosphotransferase; EC 2.7.1.229 from Salmonella typhi (see paper)
31% identity, 99% coverage: 1:301/303 of query aligns to 1:302/306 of P0DX97
- M10 (≠ N10) Important for substrate specificity; mutation to N: 2.5-fold decrease in Vmax for deoxyribokinase activity and 70-fold increase in KM for deoxyribose. 2-fold increase in KM for ribose.
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
32% identity, 99% coverage: 3:302/303 of query aligns to 5:310/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N181), K225 (≠ T219), G227 (= G221), I246 (vs. gap), A248 (≠ K240), A257 (= A249), G258 (= G250), F261 (= F253), A286 (= A278), S287 (≠ A279)
- binding alpha-D-ribofuranose: N12 (= N10), D14 (= D12), G40 (= G38), K41 (= K39), N44 (= N42), E144 (= E137), D259 (= D251)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 98% coverage: 5:302/303 of query aligns to 73:376/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
3go6B Crystal structure of m. Tuberculosis ribokinase (rv2436) in complex with ribose and amp-pnp
39% identity, 85% coverage: 3:261/303 of query aligns to 4:240/287 of 3go6B
- active site: G227 (= G248), A228 (= A249), G229 (= G250), D230 (= D251)
- binding adenosine-5'-diphosphate: G200 (= G221), V201 (≠ A222), G203 (= G224), V220 (= V241), T225 (= T246), A228 (= A249), G229 (= G250)
- binding magnesium ion: D224 (= D245), A226 (≠ V247)
Sites not aligning to the query:
Query Sequence
>CCNA_01001 CCNA_01001 ribokinase
MTVFVLGSINLDAVARVDDLPRPGETVAGLSLELFLGGKGANQAVAAARMGVATRLMGAV
GGDDSGAGLKAKLAGYGVQVGDVVELPGVPTGQAHVWVANSAENMIVVTAGANAMVTPQQ
VAATTIEGQRVLLCQLETPATAIETLFRAGSAKGALRILNAAPALPQGAALFPLTDILIV
NQTELATYAKLDREPVKLEEVSVAARKLMSRPDQTIIVTLGAAGAAVVRRDEAFLVEGKK
VKAVDTVGAGDCFCGALAATLAAGMDLAEAVETANAAAALSVQKAGAAPSMPNRREVEAF
LEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory