Comparing CCNA_01012 FitnessBrowser__Caulo:CCNA_01012 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4f0lB Crystal structure of amidohydrolase from brucella melitensis
54% identity, 96% coverage: 18:459/459 of query aligns to 9:449/449 of 4f0lB
Q9HU77 Formimidoylglutamate deiminase; Formiminoglutamate deiminase; N-formimino-L-glutamate deiminase; N-formimino-L-glutamate iminohydrolase; EC 3.5.3.13 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
51% identity, 97% coverage: 12:458/459 of query aligns to 2:452/453 of Q9HU77
4rdvB The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-formimino-l-aspartate
51% identity, 97% coverage: 12:458/459 of query aligns to 1:451/451 of 4rdvB
3mduA The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-guanidino-l-glutamate (see paper)
51% identity, 97% coverage: 12:457/459 of query aligns to 1:450/450 of 3mduA
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
25% identity, 83% coverage: 57:435/459 of query aligns to 59:408/434 of 4f0sA
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
25% identity, 83% coverage: 57:435/459 of query aligns to 59:408/436 of 4f0rA
3lnpA Crystal structure of amidohydrolase family protein olei01672_1_465 from oleispira antarctica (see paper)
25% identity, 89% coverage: 33:439/459 of query aligns to 30:418/441 of 3lnpA
Q58936 5'-deoxyadenosine deaminase; 5'-dA deaminase; 5'-methylthioadenosine deaminase; MTA deaminase; Adenosine deaminase; S-adenosylhomocysteine deaminase; SAH deaminase; EC 3.5.4.41; EC 3.5.4.31; EC 3.5.4.4; EC 3.5.4.28 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
21% identity, 84% coverage: 56:439/459 of query aligns to 47:398/420 of Q58936
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
27% identity, 84% coverage: 46:432/459 of query aligns to 41:409/439 of 4dzhA
8is4A Structure of an isocytosine specific deaminase vcz in complexed with 5-fu (see paper)
25% identity, 86% coverage: 27:423/459 of query aligns to 23:410/452 of 8is4A
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
29% identity, 51% coverage: 206:439/459 of query aligns to 180:413/435 of 4gbdA
Sites not aligning to the query:
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
29% identity, 51% coverage: 206:439/459 of query aligns to 180:413/437 of 4dykA
Sites not aligning to the query:
3hpaA Crystal structure of an amidohydrolase gi:44264246 from an evironmental sample of sargasso sea (see paper)
24% identity, 86% coverage: 27:421/459 of query aligns to 22:384/428 of 3hpaA
4v1xE The structure of the hexameric atrazine chlorohydrolase, atza (see paper)
24% identity, 92% coverage: 20:439/459 of query aligns to 20:436/474 of 4v1xE
P72156 Atrazine chlorohydrolase; EC 3.8.1.8 from Pseudomonas sp. (strain ADP) (see 2 papers)
24% identity, 92% coverage: 20:439/459 of query aligns to 20:436/474 of P72156
3lscA Crystal structure of the mutant e241q of atrazine chlorohydrolase trzn from arthrobacter aurescens tc1 complexed with zinc and atraton
26% identity, 74% coverage: 56:395/459 of query aligns to 55:391/453 of 3lscA
3lsbA Crystal structure of the mutant e241q of atrazine chlorohydrolase trzn from arthrobacter aurescens tc1 complexed with zinc and ametrin
26% identity, 74% coverage: 56:395/459 of query aligns to 55:391/453 of 3lsbA
5hmdA Crystal structure of triazine hydrolase variant (y215h/e241q) (see paper)
26% identity, 74% coverage: 56:395/459 of query aligns to 57:393/456 of 5hmdA
Q9EYU0 Melamine deaminase; EC 3.5.4.45 from Paracidovorax citrulli (Acidovorax citrulli) (see paper)
23% identity, 92% coverage: 20:439/459 of query aligns to 20:436/474 of Q9EYU0
2plmA Crystal structure of the protein tm0936 from thermotoga maritima complexed with zn and s-inosylhomocysteine (see paper)
24% identity, 43% coverage: 210:405/459 of query aligns to 168:350/404 of 2plmA
Sites not aligning to the query:
>CCNA_01012 FitnessBrowser__Caulo:CCNA_01012
MTDTQIPESVSTVVWCESALLADGWARGVKFTIADGRIARIDTDAPAGDALRLGPALPGL
GNVHSHAFQRAMAGLAETRGETGDNFWTWREVMYRFLARLDPDMAQAIAAMGQVEMLEGG
FTRVGEFHYLHHAPDGGFYDNPAEMAARMAAAADETGIGLTLLPVFYAHSNFGGLPPTDG
QKRFIHDVDGFARLVEACRGIVAGLPEAVVGIAPHSLRAVTGEELDAILPLAAGGPVHMH
VAEQTKEVDDCLAATGQRPVRWLMNHTEVDQRWCLIHATHINATETERLAKSGAVAGLCP
VTEANLGDGIFPTPDYLAAGGRFGIGTDSNIVIDAAQELRTLEYAQRLSRRARNVLASGP
RRATGGDLWRAAALGGAQALGAGRGELRRGAPADFLTLDPNHPNLVGRTGDTLIDSLVFA
GGGIDTVWRQGRQLVSGGRHHAREAITTRYVQTLQALLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory