SitesBLAST
Comparing CCNA_01018 FitnessBrowser__Caulo:CCNA_01018 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q53TZ2 L-arabinose 1-dehydrogenase (NAD(P)(+)); D-galactose 1-dehydrogenase; EC 1.1.1.376; EC 1.1.1.120; EC 1.1.1.48 from Azospirillum brasilense (see paper)
54% identity, 99% coverage: 1:305/307 of query aligns to 4:307/309 of Q53TZ2
- D169 (= D167) mutation to A: Loss of activity.
- N173 (= N171) mutation to A: Decrease by 4 orders of magnitude in catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7cgqA Crystal structure of azospirillum brasilense l-arabinose 1- dehydrogenase e147a mutant (NADP and l-arabinose bound form)
54% identity, 99% coverage: 1:305/307 of query aligns to 1:304/306 of 7cgqA
- binding alpha-L-arabinopyranose: K88 (= K89), H116 (= H117), H150 (= H151), P167 (= P168), N170 (= N171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), K11 (= K11), I12 (= I12), S34 (= S34), R35 (≠ H35), H36 (≠ G36), C64 (= C65), A65 (≠ T66), P66 (= P67), V69 (= V70), E87 (= E88), K88 (= K89), H116 (= H117), Q153 (= Q154), W155 (= W156), D166 (= D167), Y263 (= Y264)
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
34% identity, 42% coverage: 1:128/307 of query aligns to 3:136/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), G12 (= G10), A13 (≠ K11), Q14 (≠ I12), D36 (vs. gap), S37 (vs. gap), R41 (≠ H35), A73 (≠ C65), G74 (≠ T66), L78 (≠ V70), E96 (= E88), K97 (= K89), N125 (≠ H117)
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
35% identity, 39% coverage: 2:120/307 of query aligns to 4:126/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (≠ W116)
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), G12 (= G10), R13 (≠ K11), A14 (= A13), D35 (≠ S34), P36 (≠ H35), R37 (≠ G36), A71 (≠ C65), S72 (≠ T66), P73 (= P67), F76 (≠ V70), Q80 (≠ T74), E94 (= E88), K95 (= K89), P96 (= P90)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
31% identity, 45% coverage: 1:138/307 of query aligns to 1:143/333 of Q2I8V6
- ASTI 9:12 (≠ LGKI 9:12) binding
- S10 (≠ G10) mutation to G: Almost no effect.
- A13 (= A13) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ V30) mutation to D: No activity.
- ST 33:34 (≠ VA 30:31) binding
- R38 (≠ H35) binding
- TTNELH 71:76 (≠ TPPQVR 66:71) binding
- EK 93:94 (= EK 88:89) binding
- K94 (= K89) mutation to G: Less than 1% remaining activity.
- N120 (≠ S115) binding
Sites not aligning to the query:
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
37% identity, 30% coverage: 48:138/307 of query aligns to 53:142/332 of 2glxA
Sites not aligning to the query:
- active site: 179
- binding acetate ion: 179
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 7, 8, 9, 10, 11, 32, 33, 37, 161, 162, 282
7xr9A Crystal structure of dgpa with glucose (see paper)
28% identity, 45% coverage: 13:149/307 of query aligns to 16:151/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K89), R150 (= R148)
- binding nicotinamide-adenine-dinucleotide: D51 (= D48), Y52 (≠ I49), C67 (= C65), T68 (= T66), P69 (= P67), H73 (≠ R71), E90 (= E88), K91 (= K89), P92 (= P90), Q119 (≠ H117)
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
32% identity, 45% coverage: 1:138/307 of query aligns to 1:143/333 of 4koaA
- active site: K94 (= K89)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), A9 (≠ L9), S10 (≠ G10), T11 (≠ K11), I12 (= I12), S33 (≠ A31), S34 (≠ A32), R38 (≠ G36), T71 (= T66), N73 (≠ P68), H76 (≠ R71), K94 (= K89)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
26% identity, 58% coverage: 6:183/307 of query aligns to 36:229/381 of 1rydA
- active site: K129 (= K89), Y217 (≠ N171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (= L9), G40 (= G10), K41 (= K11), Y42 (≠ I12), S64 (= S34), G65 (≠ H35), K69 (≠ T39), Y87 (vs. gap), L106 (≠ T66), P107 (= P67), N108 (≠ P68), L110 (≠ V70), H111 (≠ R71), E128 (= E88), K129 (= K89), R157 (≠ H117), A196 (≠ G153), W199 (= W156), R200 (≠ I157), Y217 (≠ N171)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
27% identity, 58% coverage: 6:183/307 of query aligns to 7:200/340 of 1evjA
- active site: K100 (= K89), Y188 (≠ N171)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), L10 (= L9), G11 (= G10), K12 (= K11), Y13 (≠ I12), D35 (vs. gap), L77 (≠ T66), P78 (= P67), N79 (≠ P68), H82 (≠ R71), E99 (= E88), K100 (= K89), R128 (≠ H117), W170 (= W156), R171 (≠ I157), Y188 (≠ N171)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
26% identity, 58% coverage: 6:183/307 of query aligns to 38:231/383 of 1h6dA
- active site: K131 (= K89), Y219 (≠ N171)
- binding glycerol: K131 (= K89), R202 (≠ I157), D215 (= D167), Y219 (≠ N171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G8), L41 (= L9), G42 (= G10), K43 (= K11), Y44 (≠ I12), S66 (= S34), G67 (≠ H35), K71 (≠ T39), Y89 (vs. gap), I107 (≠ C65), L108 (≠ T66), P109 (= P67), N110 (≠ P68), H113 (≠ R71), E130 (= E88), K131 (= K89), R159 (≠ H117), A198 (≠ G153), W201 (= W156), R202 (≠ I157), Y219 (≠ N171)
Sites not aligning to the query:
7xreC Crystal structure of dgpa (see paper)
27% identity, 45% coverage: 13:149/307 of query aligns to 16:161/363 of 7xreC
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
21% identity, 91% coverage: 2:279/307 of query aligns to 4:291/325 of 1zh8A
- active site: K98 (= K89), H187 (≠ N171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G8), C11 (≠ L9), G12 (= G10), I13 (≠ K11), A14 (≠ I12), S37 (≠ H35), R38 (≠ G36), T39 (≠ R37), H42 (= H40), T74 (≠ C65), L75 (≠ T66), P76 (= P67), L79 (≠ V70), E97 (= E88), K98 (= K89), N126 (≠ H117), Y165 (≠ H151), W170 (= W156), R171 (≠ I157), H187 (≠ N171), Y276 (= Y264)
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
32% identity, 38% coverage: 6:122/307 of query aligns to 8:134/336 of 5a06A
- active site: K101 (= K89)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (= L9), G12 (= G10), Y13 (≠ K11), Y14 (≠ I12), S36 (≠ H35), G37 (= G36), T38 (≠ R37), K41 (vs. gap), Y59 (vs. gap), I77 (≠ C65), T78 (= T66), P79 (= P67), N80 (≠ P68), L82 (≠ V70), H83 (≠ R71), E100 (= E88), K101 (= K89), R129 (≠ H117)
- binding sorbitol: D72 (= D60), H96 (= H84), K101 (= K89), R122 (≠ V110), R122 (≠ V110), L124 (= L112)
Sites not aligning to the query:
- active site: 186
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 168, 169, 186, 264
- binding sorbitol: 2, 160, 169, 182, 186, 287, 296, 299, 306, 310, 311
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
32% identity, 38% coverage: 6:122/307 of query aligns to 8:134/336 of 5a03C
- active site: K101 (= K89)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G8), L11 (= L9), G12 (= G10), Y13 (≠ K11), Y14 (≠ I12), S36 (≠ H35), G37 (= G36), T38 (≠ R37), K41 (vs. gap), Y59 (vs. gap), I77 (≠ C65), T78 (= T66), P79 (= P67), N80 (≠ P68), L82 (≠ V70), H83 (≠ R71), E100 (= E88), K101 (= K89), R129 (≠ H117)
- binding beta-D-xylopyranose: K101 (= K89)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
32% identity, 38% coverage: 6:122/307 of query aligns to 7:133/335 of 5a05A
- active site: K100 (= K89)
- binding beta-D-glucopyranose: K100 (= K89)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), L10 (= L9), G11 (= G10), Y12 (≠ K11), Y13 (≠ I12), S35 (≠ H35), G36 (= G36), T37 (≠ R37), K40 (vs. gap), Y58 (vs. gap), I76 (≠ C65), T77 (= T66), P78 (= P67), N79 (≠ P68), L81 (≠ V70), H82 (≠ R71), E99 (= E88), K100 (= K89), R128 (≠ H117)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
32% identity, 38% coverage: 6:122/307 of query aligns to 7:133/335 of 5a04A
- active site: K100 (= K89)
- binding beta-D-glucopyranose: K100 (= K89)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (= L9), G11 (= G10), Y12 (≠ K11), Y13 (≠ I12), S35 (≠ H35), G36 (= G36), T37 (≠ R37), K40 (vs. gap), Y58 (vs. gap), I76 (≠ C65), T77 (= T66), P78 (= P67), N79 (≠ P68), L81 (≠ V70), H82 (≠ R71), E99 (= E88), K100 (= K89), R128 (≠ H117)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
32% identity, 38% coverage: 6:122/307 of query aligns to 7:133/335 of 5a03E
- active site: K100 (= K89)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), L10 (= L9), G11 (= G10), Y12 (≠ K11), Y13 (≠ I12), S35 (≠ H35), G36 (= G36), T37 (≠ R37), K40 (vs. gap), Y58 (vs. gap), I76 (≠ C65), T77 (= T66), P78 (= P67), N79 (≠ P68), H82 (≠ R71), E99 (= E88), K100 (= K89), R128 (≠ H117)
- binding beta-D-xylopyranose: K100 (= K89)
Sites not aligning to the query:
- active site: 185
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 167, 168, 185, 263
- binding beta-D-xylopyranose: 159, 168, 181, 185, 205, 207, 209
- binding alpha-D-xylopyranose: 134, 268, 279, 280
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
32% identity, 38% coverage: 6:122/307 of query aligns to 7:133/335 of 5a02A
- active site: K100 (= K89)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (= L9), G11 (= G10), Y12 (≠ K11), Y13 (≠ I12), S35 (≠ H35), G36 (= G36), T37 (≠ R37), K40 (vs. gap), Y58 (vs. gap), I76 (≠ C65), T77 (= T66), P78 (= P67), L81 (≠ V70), H82 (≠ R71), E99 (= E88), K100 (= K89), R128 (≠ H117)
Sites not aligning to the query:
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
28% identity, 44% coverage: 2:136/307 of query aligns to 3:144/340 of 4n54A
- active site: K96 (= K89)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (≠ K11), K96 (= K89)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (= V7), G9 (= G8), L10 (= L9), G11 (= G10), R12 (≠ K11), L13 (≠ I12), S35 (≠ H35), V36 (≠ G36), E40 (≠ H40), S73 (≠ T66), P74 (= P67), F77 (≠ V70), H78 (≠ R71), E95 (= E88), K96 (= K89), M125 (≠ H117)
Sites not aligning to the query:
- active site: 183
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: 156, 179, 180, 183, 238, 244
- binding 1,4-dihydronicotinamide adenine dinucleotide: 167, 284
Query Sequence
>CCNA_01018 FitnessBrowser__Caulo:CCNA_01018
MIRIGLVGLGKIAHDQHLPALAGDPRFSLVAAASHGRPTHGDLPVFHDIDDLLANGPALD
AVALCTPPQVRRETALAALRAGKHVFLEKPPGVTVGEVHELAAVARDQGVTLFTSWHSRF
AAGVPQAKAWLAKRRLRKLAIEWREDVRRWHPGQAWIWQAGGMGVFDPAINALSILTEIM
PEEVFVTGAKLQVPENVQAPIAGHVDITTLSGVPVTADLDFLQTGPQTWDITAWTDDGVL
KLSLGGAELTIDGQAIPVGENREYPGLYDRFATLIAEGRSEVDVRPLSLVADAFLVGDRE
RVEAFVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory