Comparing CCNA_01019 FitnessBrowser__Caulo:CCNA_01019 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x41A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose (see paper)
32% identity, 91% coverage: 51:739/758 of query aligns to 1:700/715 of 2x41A
2x42A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose (see paper)
32% identity, 91% coverage: 51:739/758 of query aligns to 1:700/715 of 2x42A
5wabA Crystal structure of bifidobacterium adolescentis gh3 beta-glucosidase (see paper)
34% identity, 88% coverage: 90:753/758 of query aligns to 20:654/674 of 5wabA
4i8dB Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
34% identity, 82% coverage: 128:747/758 of query aligns to 74:714/714 of 4i8dB
Sites not aligning to the query:
4i8dA Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
34% identity, 82% coverage: 128:747/758 of query aligns to 71:711/711 of 4i8dA
Sites not aligning to the query:
6jxgA Crystasl structure of beta-glucosidase d2-bgl from chaetomella raphigera (see paper)
34% identity, 85% coverage: 93:738/758 of query aligns to 41:704/713 of 6jxgA
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
30% identity, 86% coverage: 100:753/758 of query aligns to 92:748/765 of 7zb3A
Sites not aligning to the query:
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
30% identity, 86% coverage: 100:753/758 of query aligns to 92:748/763 of 7zdyW
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
30% identity, 86% coverage: 100:753/758 of query aligns to 92:737/753 of 7zgzX
4iigA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with d-glucose (see paper)
31% identity, 79% coverage: 41:641/758 of query aligns to 11:641/834 of 4iigA
Sites not aligning to the query:
4iieA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with calystegine b(2) (see paper)
31% identity, 79% coverage: 41:641/758 of query aligns to 11:641/834 of 4iieA
Sites not aligning to the query:
4iidA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with 1-deoxynojirimycin (see paper)
31% identity, 79% coverage: 41:641/758 of query aligns to 11:641/834 of 4iidA
Sites not aligning to the query:
4iibA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus (see paper)
31% identity, 79% coverage: 41:641/758 of query aligns to 11:641/834 of 4iibA
Sites not aligning to the query:
4iifA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with castanospermine (see paper)
31% identity, 79% coverage: 41:641/758 of query aligns to 11:641/833 of 4iifA
Sites not aligning to the query:
4iihA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with thiocellobiose (see paper)
31% identity, 79% coverage: 41:641/758 of query aligns to 11:641/833 of 4iihA
Sites not aligning to the query:
4iicA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with isofagomine (see paper)
31% identity, 79% coverage: 41:641/758 of query aligns to 11:641/833 of 4iicA
Sites not aligning to the query:
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
30% identity, 92% coverage: 48:741/758 of query aligns to 2:729/733 of 5tf0A
5ju6A Structural and functional studies of glycoside hydrolase family 3 beta-glucosidase cel3a from the moderately thermophilic fungus rasamsonia emersonii (see paper)
31% identity, 73% coverage: 91:642/758 of query aligns to 53:638/835 of 5ju6A
Sites not aligning to the query:
5fjjA Three-dimensional structures of two heavily n-glycosylated aspergillus sp. Family gh3 beta-d-glucosidases (see paper)
30% identity, 79% coverage: 41:641/758 of query aligns to 11:641/839 of 5fjjA
Sites not aligning to the query:
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
29% identity, 85% coverage: 100:740/758 of query aligns to 73:729/742 of 3u48B
>CCNA_01019 FitnessBrowser__Caulo:CCNA_01019
MISTTLRSLSLALLISASASALSVVPALADAAKPAAALAHPWMDKSLDADKRADLVLKAM
TNDEKFTLIFGYFGADMKPKYTRIPESLPGSAGYIAGVPRLGIPAQFQTDAGVGVATQGS
AKEFRERTALPSGMATTATWNPELAFQGGAMIGKEARDSGFNVQLAGGVNLVREPRNGRN
FEYGGEDPLLAGVMVAAQIRGIQSNNIISTIKHYALNAQETGRFVVSSNIDDTAARMSDL
LAFQFAIEQSDPHSVMCAYNRVNSVYACESDWLLNTVLKKDWGYKGYVMSDWGAAHSSAK
AANAGLDQESAGDAFDKQPFFAAPLKADLASGAVSQARIDDMARRVLRAMFASGVVDHPL
TGAPLAMPAETLAAHAKITQADAEEGIVLLKNDGGLLPLAKTAKTIAVIGSYADVGVLSG
GGSSQVYPVGGRAVQGLEPKTWPGPVIYYPSSPLKAIAARYPGAKVVYDDGTDPARAAKL
AASSDLALVFADQWTTESVDVTTLNLPKNQDATIDAVASANKKTVVVLLTGGPLLMPWLD
KVGAVVEAWFPGTAGGEAIARVLTGEVDASGRLPVTFPKSVAELPRPKLDGLGKPDGEMF
DVDYTLEGAAVGYKWYDLKKIEPLFAFGHGLSYTQFAYSNLTASASGDTLTVSFEVKNVG
RRPGKDVPQVYVGPKAGGWEAPKRLAGFQKVSLAPGASQRVTVTVDPRLLAVWDSKAHGW
SIAAGQYDIALGASSRAISSTAQVTLAARSLPVSPAAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory