Comparing CCNA_01071 FitnessBrowser__Caulo:CCNA_01071 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
24% identity, 77% coverage: 48:412/477 of query aligns to 37:378/437 of 6rw3A
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 34% coverage: 73:236/477 of query aligns to 98:268/583 of Q9Y7Q9
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
24% identity, 79% coverage: 79:457/477 of query aligns to 78:428/452 of Q5EXK5
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
24% identity, 79% coverage: 56:434/477 of query aligns to 43:425/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
24% identity, 79% coverage: 56:434/477 of query aligns to 43:425/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
24% identity, 79% coverage: 56:434/477 of query aligns to 43:425/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
24% identity, 79% coverage: 56:434/477 of query aligns to 47:429/491 of P0AGF4
Sites not aligning to the query:
6m2lA Crystal structure of plasmodium falciparum hexose transporter pfht1 bound with c3361 (see paper)
23% identity, 70% coverage: 81:412/477 of query aligns to 66:378/447 of 6m2lA
Sites not aligning to the query:
>CCNA_01071 FitnessBrowser__Caulo:CCNA_01071
MTATTEATRLTPVARARAILGGSAGNLVEWYDWFAYAAFTLYFAPAFFPKGDQTVQLLQA
AAVFFLGFVARPIGAWIMGLYADHAGRRAALSVSVSLMCAGAFIIAITPDFQTIGLWAPA
ILLFARVLQGLSVGGEYGASATYMSEMAGKARRGFWSSFHYVTLIAGQLLALGVLIILQR
TLGEEALKEWAWRVPFIIGALLAVVVFWIRRGLEESVSFKRPAQSETLSRGQIISAGAFL
SLTIASGVVGLMGGPLAKAGQYLGAAFLVLFFVSLIVPLIRRHPRESLLIMGLTAGGSLT
FYVYTTYMQKFLVNTAGFSKAQASEISALSLIAFMLMQPLAGWLSDRFGRKPMLIIAFGG
GVLTIWPIMTAISQTNSVGVALALILVGVAFQSCYTAISAVVKAEMFPAEIRALGVALPY
ALANVLFGGTAEMVALAFKHENLESTFYVYVAAVMTIGLICSIILKDTGRHSLIHED
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory