Comparing CCNA_01124 FitnessBrowser__Caulo:CCNA_01124 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
32% identity, 90% coverage: 3:314/347 of query aligns to 21:338/354 of 3ly1D
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
33% identity, 91% coverage: 3:317/347 of query aligns to 27:342/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
33% identity, 91% coverage: 3:317/347 of query aligns to 27:342/353 of 4r2nA
Sites not aligning to the query:
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
27% identity, 90% coverage: 3:313/347 of query aligns to 37:348/360 of 8bj3A
Sites not aligning to the query:
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
27% identity, 82% coverage: 39:323/347 of query aligns to 61:351/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
27% identity, 82% coverage: 39:323/347 of query aligns to 61:351/354 of 1fg3A
Sites not aligning to the query:
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
27% identity, 79% coverage: 39:313/347 of query aligns to 47:327/335 of 1geyA
Sites not aligning to the query:
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
25% identity, 79% coverage: 39:313/347 of query aligns to 61:341/353 of 7szpA
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
24% identity, 89% coverage: 6:313/347 of query aligns to 28:324/335 of 2f8jA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
24% identity, 89% coverage: 6:313/347 of query aligns to 27:323/335 of Q9X0D0
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
24% identity, 89% coverage: 6:313/347 of query aligns to 22:318/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
24% identity, 89% coverage: 6:313/347 of query aligns to 22:318/329 of 1h1cA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
24% identity, 89% coverage: 6:313/347 of query aligns to 21:317/328 of 1uu0A
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
28% identity, 91% coverage: 3:317/347 of query aligns to 30:352/364 of 3cq6A
Sites not aligning to the query:
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
28% identity, 91% coverage: 3:317/347 of query aligns to 32:354/366 of 3cq5B
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
28% identity, 91% coverage: 3:317/347 of query aligns to 32:354/369 of 4r8dA
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
27% identity, 59% coverage: 3:205/347 of query aligns to 36:240/369 of 4wbtA
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
28% identity, 52% coverage: 29:209/347 of query aligns to 61:256/402 of 5wmiA
Sites not aligning to the query:
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
28% identity, 52% coverage: 29:209/347 of query aligns to 61:256/399 of 5wmhA
O84395 LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 from Chlamydia trachomatis (strain D/UW-3/Cx) (see paper)
31% identity, 39% coverage: 66:200/347 of query aligns to 109:247/394 of O84395
Sites not aligning to the query:
>CCNA_01124 FitnessBrowser__Caulo:CCNA_01124
MLINANENPLGPSKAACDAIARVAPLGGRYDLTGETELLTKTIAAQSGLKPEFIAVYAGS
SEPLHYSVLAFTSPTKSFVTADPSYEAGMFAARTSQAKIIKTPLTSAFAHDVKAMVAADA
QAGVIYICNPNNPTGTLTTKKDIVWALENKPAGSILLVDEAYIHLTDEPDTLDLVAQGKD
LIVLRTFSKIYGMAGIRCGFAAGRPDLLAKLKPFGQNAMPITGSAAARASLEDPKLVPER
RKMIGDTRRDTIAWLKTNGYKVIGDPQTNCFMIDTGRNGRAVMAAMKARNVMIGRTWPIW
PNAVRVSVGTPEEMAAFKVAFKAVMDGPPLAEADHVQLAQLDGYVAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory