SitesBLAST
Comparing CCNA_01161 FitnessBrowser__Caulo:CCNA_01161 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
34% identity, 92% coverage: 18:429/448 of query aligns to 15:420/425 of O59010
- S65 (≠ A73) mutation to V: Strongly decreased chloride conductance.
- R276 (= R290) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (= RSS 290:292) binding
- M311 (= M326) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ C329) binding
- V355 (≠ L371) binding
- D394 (= D403) binding
- M395 (= M404) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R406) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N410) binding
- D405 (≠ Q414) mutation to N: Strongly decreased affinity for aspartate.
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
34% identity, 92% coverage: 18:428/448 of query aligns to 15:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ V54), F46 (≠ V54), P75 (≠ Q83), L91 (≠ V100), F95 (≠ I104), L130 (≠ W138), I133 (≠ F141), I159 (≠ V173), Y167 (≠ L181), K196 (= K210), G200 (≠ W214), I207 (= I221), F210 (≠ V224), L250 (= L264), I262 (≠ F276), M269 (≠ I283), T334 (≠ V350), V335 (≠ W351), G336 (≠ S352), T340 (≠ L356), L343 (≠ F359), M399 (≠ A408)
- binding aspartic acid: S277 (= S291), S278 (= S292), T314 (≠ C329), G354 (= G370), A358 (= A374), G359 (vs. gap), D394 (= D403), R397 (= R406), T398 (= T407)
- binding sodium ion: Y89 (≠ F98), T92 (= T101), S93 (≠ A102), G306 (= G321), T308 (= T323), N310 (≠ K325), N310 (≠ K325), M311 (= M326), D312 (= D327), S349 (= S365), I350 (≠ A366), T352 (= T368), N401 (= N410), V402 (= V411), D405 (≠ Q414)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
33% identity, 91% coverage: 18:426/448 of query aligns to 7:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
33% identity, 91% coverage: 18:425/448 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S292), M303 (= M326), T306 (≠ C329), A345 (= A369), G346 (= G370), V347 (≠ L371), G351 (vs. gap), D386 (= D403), C389 (≠ R406), T390 (= T407), N393 (= N410)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
33% identity, 91% coverage: 18:425/448 of query aligns to 6:407/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
34% identity, 91% coverage: 18:425/448 of query aligns to 12:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (≠ S77), V83 (≠ L95), I157 (≠ L174), Y164 (≠ L181), K193 (= K210), T305 (= T323), I306 (≠ T324), I347 (≠ A366)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V19), M199 (≠ I216), S275 (= S292), T311 (≠ C329), G356 (vs. gap), L384 (= L396), D391 (= D403), R394 (= R406)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
32% identity, 91% coverage: 18:425/448 of query aligns to 7:396/396 of 6bmiA
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
32% identity, 92% coverage: 18:429/448 of query aligns to 11:418/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
32% identity, 92% coverage: 18:429/448 of query aligns to 10:417/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ R209), G195 (≠ W214), R282 (≠ T301)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (= R290), S272 (= S291), S273 (= S292), M307 (= M326), T310 (≠ C329), G353 (= G373), A354 (= A374), R394 (= R406), T395 (= T407)
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
32% identity, 92% coverage: 18:429/448 of query aligns to 13:420/427 of 5e9sA
- binding aspartic acid: R274 (= R290), S275 (= S291), S276 (= S292), T313 (≠ C329), G353 (= G370), V354 (≠ L371), A357 (= A374), G358 (vs. gap), D394 (= D403), R397 (= R406), T398 (= T407)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R209), G198 (≠ W214), Y202 (≠ L218)
- binding sodium ion: Y87 (≠ F98), T90 (= T101), S91 (≠ A102), S276 (= S292), G305 (= G321), A306 (= A322), T307 (= T323), N309 (≠ K325), N309 (≠ K325), M310 (= M326), D311 (= D327), S348 (= S365), I349 (≠ A366), G350 (≠ A367), T351 (= T368), N401 (= N410), V402 (= V411), D405 (≠ Q414)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
32% identity, 92% coverage: 18:429/448 of query aligns to 13:420/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
32% identity, 92% coverage: 18:429/448 of query aligns to 6:409/416 of 6r7rA
- binding d-aspartic acid: R263 (= R290), S265 (= S292), M299 (= M326), T302 (≠ C329), T340 (= T368), G342 (= G370), V343 (≠ L371), G347 (vs. gap), D383 (= D403), R386 (= R406), T387 (= T407), N390 (= N410)
- binding decyl-beta-d-maltopyranoside: H23 (≠ Q35), V212 (≠ L239), A216 (≠ G243)
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 81% coverage: 55:416/448 of query aligns to 57:393/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ A87), G89 (≠ A88), G92 (≠ V91), A95 (≠ T94), V96 (≠ L95), Y99 (≠ F98), M163 (≠ L181), F167 (≠ V185), F293 (= F316), V297 (≠ L320)
- binding aspartic acid: S268 (= S291), S269 (= S292), T306 (≠ C329), G346 (= G373), I347 (vs. gap), A350 (vs. gap), G351 (≠ A374), D380 (= D403), R383 (= R406), T384 (= T407)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
31% identity, 81% coverage: 55:416/448 of query aligns to 49:379/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I78), S80 (≠ A87), G81 (≠ A88), G84 (≠ V91), Y91 (≠ F98), M156 (≠ L181), F160 (≠ V185), F286 (= F316), V290 (≠ L320)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V70), I148 (≠ V173), S262 (= S292), S263 (≠ I293), A292 (= A322), T293 (= T323), M296 (= M326), T299 (≠ A330), G329 (= G370), A336 (vs. gap), G337 (≠ A374), D366 (= D403), R369 (= R406), N373 (= N410)
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
31% identity, 81% coverage: 55:415/448 of query aligns to 39:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ A73), L58 (≠ I74), L65 (≠ I81), V339 (≠ A366), G340 (≠ A367), S343 (≠ G370), I344 (≠ L371)
- binding cholesterol: W188 (≠ R217), I227 (≠ G254), F250 (= F276), W257 (≠ I283), M379 (≠ G405), S382 (≠ A408)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S292), M300 (= M326), T303 (≠ A330), Y306 (= Y333), G348 (vs. gap), L349 (≠ T375), M352 (≠ L378), I366 (≠ A392), L369 (= L395), V370 (≠ L396), D373 (= D399), D377 (= D403), R380 (= R406), T381 (= T407), N384 (= N410)
Sites not aligning to the query:
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
26% identity, 85% coverage: 55:435/448 of query aligns to 56:469/503 of Q10901
- N177 (≠ G163) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
29% identity, 92% coverage: 7:416/448 of query aligns to 31:469/532 of O35874
- N201 (≠ S168) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
30% identity, 81% coverage: 55:415/448 of query aligns to 47:404/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S291), S281 (= S292), T318 (≠ A330), G363 (vs. gap), M367 (≠ L378), V385 (≠ L396), D388 (= D399), R395 (= R406), T396 (= T407)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ P400)
- binding cholesterol hemisuccinate: R80 (= R89), R84 (= R93), I95 (= I104), I252 (≠ L264)
Sites not aligning to the query:
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
31% identity, 74% coverage: 93:423/448 of query aligns to 80:421/433 of 8cv2A
- binding sodium ion: Y85 (≠ F98), T88 (= T101), T89 (≠ A102), G319 (= G321), A320 (= A322), N323 (≠ K325), N323 (≠ K325), M324 (= M326), D325 (= D327), N408 (= N410), D412 (≠ Q414)
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
29% identity, 81% coverage: 55:415/448 of query aligns to 46:405/425 of 7xr4A
Query Sequence
>CCNA_01161 FitnessBrowser__Caulo:CCNA_01161
MAATQTKSSRFISGFGAQVLIAMVAGLGLGLLARQLGPAEGQAGYVLAETLRQVGQIFVQ
LLRVLVPPLVFTAIVASIANIAQMQNAARLVWRTLFWFAVTALISVVIGIALGLVLQPGL
HASLDAAAAKAPKTHGSWLDFLTGLVPVNILGLAASTKISDAGAASTSLSFNVLQIVVIS
LVTGVAALKVGEAGEAFLKFNASALAIVRKVLWWVIRLTPIGTVGLFGNAVAQYGWTTLG
QLGAFTVAIYAGLGLVLLVVYPVLLALNDLNPIRFFQGAWPAIQLAFVSRSSIGTLPVTE
TVTETRLGVPRAYAAFAVPLGATTKMDGCAAIYPAIAAIFVAQFFGVHLVWSDYLLIVFV
SVIGSAATAGLTGATVMLTLTLSTLGLPLEGAGLLLAIDPILDMGRTAVNVAGQALVPTL
VAKREGILDLEAYNRPGSHADAAFHAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory