SitesBLAST
Comparing CCNA_01191 FitnessBrowser__Caulo:CCNA_01191 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P11551 L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease; L-fucose-H(+) symport protein from Escherichia coli (strain K12) (see 3 papers)
24% identity, 84% coverage: 22:368/411 of query aligns to 34:410/438 of P11551
- W38 (≠ F26) mutation W->F,I,Y: Strong decrease in L-fucose transport.
- D46 (≠ G34) Important for activity; mutation D->A,N: Loss of L-fucose transport.
- E135 (≠ K120) Important for activity; mutation E->A,D,Q: Loss of L-fucose transport.
- W278 (≠ Y235) mutation W->F,Y: Slight decrease in L-fucose transport.; mutation to I: 30% decrease in L-fucose transport.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
25% identity, 68% coverage: 9:286/411 of query aligns to 18:324/452 of Q5EXK5
- D82 (= D74) mutation to A: Loss of activity.
- V311 (≠ W273) mutation to W: Loss of activity.
- D314 (≠ N276) mutation to A: Loss of activity.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
26% identity, 41% coverage: 9:177/411 of query aligns to 24:190/448 of Q51955
- D41 (≠ F26) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (≠ T29) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G70) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D74) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G77) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (≠ L109) mutation to A: Abolishes 4-HBA transport.
- E144 (≠ D129) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ K170) mutation to A: Decrease in 4-HBA transport and chemotaxis.
Sites not aligning to the query:
- 323 D→N: Abolishes 4-HBA transport and chemotaxis.
- 328 H→A: Decrease in 4-HBA transport and chemotaxis.; H→R: Decrease in 4-HBA transport and loss of chemotaxis.
- 386 R→A: Strong decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
P34711 Vesicular acetylcholine transporter unc-17; Uncoordinated protein 17 from Caenorhabditis elegans (see paper)
24% identity, 43% coverage: 70:247/411 of query aligns to 121:303/532 of P34711
- C230 (= C180) mutation to F: In p1160; severely uncoordinated.
Sites not aligning to the query:
- 347 G→A: In e245; severely uncoordinated.
Q8RWN2 Protein ZINC INDUCED FACILITATOR 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 27% coverage: 59:168/411 of query aligns to 88:194/486 of Q8RWN2
Sites not aligning to the query:
- 472 G→R: In zif1-3; zinc sensitivity.
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
25% identity, 38% coverage: 36:193/411 of query aligns to 137:293/605 of Q9GQQ0
- E217 (≠ I116) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
Q4U2R8 Solute carrier family 22 member 6; Organic anion transporter 1; hOAT1; PAH transporter; hPAHT; Renal organic anion transporter 1; hROAT1 from Homo sapiens (Human) (see 6 papers)
38% identity, 14% coverage: 59:116/411 of query aligns to 142:199/563 of Q4U2R8
Sites not aligning to the query:
- 7 L → P: in dbSNP:rs1415632329
- 30 L→A: Complete loss of PAH transport activity.
- 36 T→A: Complete loss of PAH transport activity.
- 39 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Complete loss of PAH transport activity.
- 50 R → H: lower Vmax; increase in substrate affinity and increase in the affinity for the nucleoside phosphonate analogs cidofovir, adefovir and tenofovir; dbSNP:rs11568626
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 92 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 104 P → L: in dbSNP:rs11568627
- 113 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 230 Y→A: Loss of membrane protein expression and little uptake of cidofovir.
- 431 K→A: Decrease in the level of membrane protein expression and 70 % loss of PAH uptake.
- 438 F→A: Decrease in the level of membrane protein expression, 70 % loss of PAH uptake, increased affinity for cidofovir, lower Vmax for PAH, and lower Km and Vmax for cidofovir.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
23% identity, 59% coverage: 34:277/411 of query aligns to 62:313/444 of Q8NLB7
- R103 (= R75) mutation to A: Loss of transport activity.
- W309 (= W273) mutation to V: Loss of transport activity.
- D312 (≠ N276) mutation to A: Loss of transport activity.
- R313 (= R277) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 57 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
8bvtA Cryo-em structure of rat slc22a6 bound to probenecid (see paper)
29% identity, 20% coverage: 59:141/411 of query aligns to 133:216/508 of 8bvtA
Sites not aligning to the query:
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
29% identity, 20% coverage: 59:141/411 of query aligns to 124:207/497 of 8bw7A
Sites not aligning to the query:
8bvsA Cryo-em structure of rat slc22a6 bound to tenofovir (see paper)
29% identity, 20% coverage: 59:141/411 of query aligns to 124:207/502 of 8bvsA
Sites not aligning to the query:
Query Sequence
>CCNA_01191 FitnessBrowser__Caulo:CCNA_01191
MTQTVSDASRDPRLIRILTYLMFMMFAMTTDSVGVIIPHVIKTFDLGMAAAGSFHYASMT
GIALGGVCLGFLADRLGRKATIVLGLVAFAVTAFLFAVGKDFGFFVALLFLSGLAIGVFK
TGALALIGDISSSTRAHTATMNMVEGFFGLGAILGPAIVTALLAQGASWKWLYVIAGALC
VLLIIAALNVRYPQTPPAAQQKLDPRVTLAMFGNPYALAFSFAIMLYVGVETAIYVWMPT
LLADYKGPAVLLAAYALSVFFILRAAGRFLGAWLLNRLSWTQVVAICSVAILICFAAALA
GGRAVAVYSLPISGLFMSVLYPTINSKGISCFPKAEHGSVSGVILFFTCVSAVIAPWMMG
LISDRFGDAVYGFALATGLAALLAVLAVLNLVFDPSRARLEARQDADYVVP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory