SitesBLAST
Comparing CCNA_01192 FitnessBrowser__Caulo:CCNA_01192 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3lm9A Crystal structure of fructokinase with adp and fructose bound in the active site (see paper)
39% identity, 93% coverage: 9:293/307 of query aligns to 3:284/294 of 3lm9A
- binding adenosine-5'-diphosphate: G130 (= G138), T131 (= T139), G182 (= G191), P183 (= P192), E186 (≠ A195), A193 (≠ G202), G231 (= G240)
- binding beta-D-fructofuranose: G60 (= G68), D104 (= D112), I133 (≠ V141), E151 (= E159), E177 (= E186)
- binding zinc ion: H154 (= H162), C169 (= C178), H172 (= H181), C175 (= C184)
1xc3A Structure of a putative fructokinase from bacillus subtilis (see paper)
39% identity, 93% coverage: 9:293/307 of query aligns to 3:284/295 of 1xc3A
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
26% identity, 92% coverage: 8:290/307 of query aligns to 2:281/290 of 6jdbA
- binding adenosine-5'-diphosphate: K12 (= K18), S129 (≠ G138), T130 (= T139), P195 (= P201), K196 (≠ G202), S241 (≠ G240)
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-mannopyranose: T62 (≠ F67), G63 (= G68), A72 (≠ T85), L73 (≠ P86), N74 (≠ K87), N77 (vs. gap), N102 (≠ T111), D103 (= D112), S129 (≠ G138), T130 (= T139), H152 (≠ E159), H155 (= H162), E174 (= E186)
- binding zinc ion: H155 (= H162), C165 (≠ G176), C167 (= C178), C172 (= C184)
6jdcA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac from haemophilus influenzae
26% identity, 92% coverage: 8:290/307 of query aligns to 2:261/269 of 6jdcA
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
27% identity, 92% coverage: 8:290/307 of query aligns to 2:282/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
27% identity, 92% coverage: 8:290/307 of query aligns to 2:282/293 of 6jdhA
2qm1B Crystal structure of glucokinase from enterococcus faecalis
25% identity, 94% coverage: 7:296/307 of query aligns to 6:321/325 of 2qm1B
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
26% identity, 81% coverage: 12:259/307 of query aligns to 7:276/304 of 7p9pAAA
- binding phosphoaminophosphonic acid-adenylate ester: G11 (= G16), T12 (= T17), K13 (= K18), G133 (= G138), T134 (= T139), G194 (= G191), E198 (≠ A195), A211 (≠ K207), G256 (= G239), G257 (= G240), N260 (≠ G243)
- binding zinc ion: H159 (= H162), C180 (≠ G176), C182 (= C178), C187 (= C184), E213 (≠ D209), H217 (≠ A213)
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
26% identity, 81% coverage: 12:259/307 of query aligns to 6:275/303 of 7p9lAAA
- binding 2-acetamido-2-deoxy-6-O-phosphono-beta-D-glucopyranose: P66 (≠ D73), G67 (≠ P74), S79 (≠ T85), N105 (≠ T111), D106 (= D112), G132 (= G138), T133 (= T139), G134 (= G140), V135 (= V141), G136 (= G142), E155 (= E159), H158 (= H162), D188 (≠ E186)
- binding zinc ion: H158 (= H162), C179 (≠ G176), C181 (= C178), C186 (= C184), E212 (≠ D209), H216 (≠ A213)
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
26% identity, 81% coverage: 12:259/307 of query aligns to 9:278/306 of 7p7wBBB
Q9Y223 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Homo sapiens (Human) (see 18 papers)
29% identity, 66% coverage: 11:214/307 of query aligns to 411:625/722 of Q9Y223
- D413 (≠ E13) binding
- G416 (= G16) binding
- T417 (= T17) binding
- N418 (≠ K18) binding
- R420 (≠ M20) binding
- I472 (≠ V64) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 50% of the wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to less than 10% of wild-type activity
- G476 (= G68) binding ; binding
- R477 (≠ P69) binding ; binding
- T489 (≠ P86) binding ; binding
- N516 (≠ T111) binding ; binding
- D517 (= D112) active site; binding ; binding ; mutation D->A,N: Loss of N-acylmannosamine kinase activity. Decreased affinity for N-acyl-D-mannosamine. No effect on structure.
- N519 (= N114) to S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs1554658910; mutation to S: Decreased N-acylmannosamine kinase activity.
- A524 (= A119) to V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 10% of wild-type activity; decreased N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs764698870
- F528 (≠ W123) to C: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70% of wild-type activity; decreased N-acylmannosamine kinase activity; dbSNP:rs986773986; mutation to C: Decreased N-acylmannosamine kinase activity.
- G545 (= G140) binding
- E566 (= E159) binding
- H569 (= H162) binding ; binding ; binding
- V572 (= V165) to L: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70-80% of wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to less than 10% of wild-type activity; does not affect homohexamers formation; dbSNP:rs121908632
- G576 (≠ P173) to E: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs121908625
- C579 (≠ G176) binding
- C581 (= C178) binding
- C586 (= C184) binding
- I587 (≠ L185) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs748949603; mutation to T: Decreased N-acylmannosamine kinase activity.
- E588 (= E186) binding ; binding
Sites not aligning to the query:
- 13 C → S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; dbSNP:rs1209266607
- 19 binding
- 23 binding
- 113 binding
- 132 H → Q: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 10% of wild-type activity; impaired homohexamers formation
- 176 D → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs139425890
- 177 R → C: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs539332585
- 200 I → F: in NM; uncertain significance; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 90% of wild-type activity; decreased N-acylmannosamine kinase activity; retains 75% of wild-type activity; dbSNP:rs369328625
- 206 G → S: in NM; moderate phenotype with unusual involvement of quadriceps; dbSNP:rs766266918
- 220 binding
- 253 binding
- 259 binding
- 263 R → L: in SIALURIA; strong reduction of feedback inhibition by CMP-Neu5Ac; dbSNP:rs121908623
- 266 R → Q: in SIALURIA; abolishes feedback inhibition by CMP-Neu5Ac; dbSNP:rs121908622; R → W: in sialuria; dbSNP:rs121908621
- 271 binding
- 280 binding
- 281 binding
- 282 binding
- 301 binding
- 302 binding
- 303 C → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 80% of wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to 60% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs121908633
- 307 binding
- 321 binding
- 331 V → A: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation
- 378 D → Y: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 10-30% of wild-type activity; decreased N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs199877522
- 630 A → T: in NM; decreased N-acylmannosamine kinase activity; does not affect homohexamers formation; dbSNP:rs1382191649
- 631 A → T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 80% of wild-type activity; decreased N-acylmannosamine kinase activity; retains 75% of wild-type activity; dbSNP:rs121908626; A → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70% of wild-type activity; decreased N-acylmannosamine kinase activity; does not affect homohexamers formation; dbSNP:rs62541771; mutation A->V,T: Decreased N-acylmannosamine kinase activity.
- 708 G → S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; severely decreased; dbSNP:rs1554657922
- 712 M→T: Decreased N-acylmannosamine kinase activity.
2yi1A Crystal structure of n-acetylmannosamine kinase in complex with n- acetyl mannosamine 6-phosphate and adp. (see paper)
30% identity, 60% coverage: 11:194/307 of query aligns to 7:192/308 of 2yi1A
- binding adenosine-5'-diphosphate: G11 (= G15), T13 (= T17), N14 (≠ K18), R16 (≠ M20), T140 (= T139), G189 (= G191)
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-mannopyranose: G12 (= G16), G71 (≠ F67), G72 (= G68), R73 (≠ P69), S84 (≠ T85), T85 (≠ P86), L87 (vs. gap), N112 (≠ T111), D113 (= D112), G139 (= G138), T140 (= T139), G141 (= G140), I142 (≠ V141), E162 (= E159), H165 (= H162), E184 (= E186)
- binding calcium ion: N112 (≠ T111), N115 (= N114), G144 (≠ V143), A161 (≠ P158)
- binding zinc ion: H165 (= H162), C175 (≠ G176), C177 (= C178), C182 (= C184)
Sites not aligning to the query:
2yhyA Structure of n-acetylmannosamine kinase in complex with n- acetylmannosamine and adp (see paper)
30% identity, 60% coverage: 11:194/307 of query aligns to 7:192/308 of 2yhyA
- binding adenosine-5'-diphosphate: G11 (= G15), G12 (= G16), T13 (= T17), N14 (≠ K18), R16 (≠ M20), T140 (= T139), G189 (= G191)
- binding calcium ion: N112 (≠ T111), N115 (= N114), G144 (≠ V143), A161 (≠ P158)
- binding zinc ion: H165 (= H162), C175 (≠ G176), C177 (= C178), C182 (= C184)
Sites not aligning to the query:
O35826 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Rattus norvegicus (Rat) (see paper)
29% identity, 66% coverage: 11:214/307 of query aligns to 411:625/722 of O35826
- D413 (≠ E13) mutation D->K,N: No effect on UDP-N-acetylglucosamine 2-epimerase activity. Does not affect feedback inhibition by CMP-Neu5Ac. Loss of N-acylmannosamine kinase activity. Does not interfere with oligomerization.
- R420 (≠ M20) mutation to M: No effect on UDP-N-acetylglucosamine 2-epimerase activity. Does not affect feedback inhibition by CMP-Neu5Ac. Loss of N-acylmannosamine kinase activity. Does not interfere with oligomerization.
Sites not aligning to the query:
- 1 UDP-N-acetylglucosamine 2-epimerase
- 49 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Does not interfere with enzyme oligomerization.
- 110 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Partial reduction of the dimerization process.
- 132 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Partial reduction of the dimerization process.
- 155 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Strong reduction of the dimerization process.
- 157 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Strong reduction of the dimerization process.
- 406:722 N-acetylmannosamine kinase
2yhwA High-resolution crystal structures of n-acetylmannosamine kinase: insights about substrate specificity, activity and inhibitor modelling. (see paper)
29% identity, 60% coverage: 11:194/307 of query aligns to 7:192/309 of 2yhwA
1woqA Crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. Strain km at 1.8 a resolution (see paper)
25% identity, 50% coverage: 90:241/307 of query aligns to 91:214/253 of 1woqA
Sites not aligning to the query:
Query Sequence
>CCNA_01192 FitnessBrowser__Caulo:CCNA_01192
MAGRPMSRIAAIELGGTKVMVAFGSGPDDLSPPLRIPTTTPAETLARIEDALAAEQGRFD
AIGVASFGPIRLDPAAPDWGHILKTPKPGWSHADVAARLVRRFDRPLALDTDVNGAAVAE
GLWGAAKGLGDYAYVTVGTGVGVGLVVNGAPTHGLLHPEAGHILVRRDAALDPFTGSCPF
HGDCLEGLISGPALAARTGAPGESLSKDDPVWALVADYLAQLVANLALIASPRRVIIGGG
VGGNPQLLEQTRTRLQTHLAGYLAPLEQRSDIDAFVAAPGLGANSGLLGAVALGLRHDAI
LRQDLMP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory