Comparing CCNA_01193 FitnessBrowser__Caulo:CCNA_01193 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3uerA Crystal structure of amylosucrase from deinococcus geothermalis in complex with turanose (see paper)
45% identity, 81% coverage: 33:527/609 of query aligns to 50:563/651 of 3uerA
3czkA Crystal structure analysis of sucrose hydrolase(suh) e322q-sucrose complex (see paper)
42% identity, 94% coverage: 33:606/609 of query aligns to 40:615/618 of 3czkA
3ueqA Crystal structure of amylosucrase from neisseria polysaccharea in complex with turanose (see paper)
35% identity, 97% coverage: 18:606/609 of query aligns to 39:629/632 of 3ueqA
Q9ZEU2 Amylosucrase; EC 2.4.1.4 from Neisseria polysaccharea (see 2 papers)
35% identity, 97% coverage: 18:606/609 of query aligns to 43:633/636 of Q9ZEU2
1jgiA Crystal structure of the active site mutant glu328gln of amylosucrase from neisseria polysaccharea in complex with the natural substrate sucrose (see paper)
35% identity, 97% coverage: 18:606/609 of query aligns to 35:625/628 of 1jgiA
1s46A Covalent intermediate of the e328q amylosucrase mutant (see paper)
34% identity, 97% coverage: 18:606/609 of query aligns to 35:625/628 of 1s46A
5gtwA The n253r mutant structures of trehalose synthase from deinococcus radiodurans display two different active-site conformations
32% identity, 78% coverage: 93:570/609 of query aligns to 26:500/548 of 5gtwA
Sites not aligning to the query:
5x7uA Trehalose synthase from thermobaculum terrenum (see paper)
31% identity, 79% coverage: 92:574/609 of query aligns to 26:497/546 of 5x7uA
Sites not aligning to the query:
5ykbD The n253f mutant structure of trehalose synthase from deinococcus radiodurans reveals an open active-site conformation (see paper)
31% identity, 78% coverage: 93:570/609 of query aligns to 26:476/523 of 5ykbD
Sites not aligning to the query:
3zoaA The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
30% identity, 79% coverage: 93:574/609 of query aligns to 29:503/548 of 3zoaA
Sites not aligning to the query:
3zo9A The structure of trehalose synthase (tres) of mycobacterium smegmatis (see paper)
30% identity, 79% coverage: 93:574/609 of query aligns to 30:504/549 of 3zo9A
Sites not aligning to the query:
4lxfA Crystal structure of m. Tuberculosis tres (see paper)
29% identity, 83% coverage: 67:574/609 of query aligns to 24:527/570 of 4lxfA
A0R6E0 Trehalose synthase/amylase TreS; Maltose alpha-D-glucosyltransferase; MTase; EC 3.2.1.1; EC 5.4.99.16 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
30% identity, 79% coverage: 93:574/609 of query aligns to 58:541/593 of A0R6E0
5jy7B Complex of mycobacterium smegmatis trehalose synthase with maltokinase (see paper)
30% identity, 79% coverage: 93:574/609 of query aligns to 42:525/571 of 5jy7B
3zoaB The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
30% identity, 79% coverage: 93:574/609 of query aligns to 42:525/571 of 3zoaB
Sites not aligning to the query:
4lxfB Crystal structure of m. Tuberculosis tres (see paper)
30% identity, 83% coverage: 67:574/609 of query aligns to 24:503/546 of 4lxfB
D7BAR0 Glucosylglycerate phosphorylase; GGa phosphorylase; GGaP; EC 2.4.1.352 from Allomeiothermus silvanus (strain ATCC 700542 / DSM 9946 / NBRC 106475 / NCIMB 13440 / VI-R2) (Thermus silvanus) (see paper)
29% identity, 88% coverage: 33:570/609 of query aligns to 19:526/555 of D7BAR0
6k5pC Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
30% identity, 40% coverage: 93:336/609 of query aligns to 27:291/531 of 6k5pC
Sites not aligning to the query:
6k5pB Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
30% identity, 40% coverage: 93:336/609 of query aligns to 27:291/531 of 6k5pB
Sites not aligning to the query:
6k5pA Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
30% identity, 40% coverage: 93:336/609 of query aligns to 27:291/531 of 6k5pA
Sites not aligning to the query:
>CCNA_01193 FitnessBrowser__Caulo:CCNA_01193
MISTASIPTPYDDAVQARFAALWPIVESRFAKLYGADARGPAVLERLKTNLLKAAHARPE
PLRALDAARAADPAWLHAPGQTAYTFYVDRFAGDLNGVRGKLDYLTELGVRWLHPLPLLE
PRPGDSDGGFAVADYRKVDPRLGTIDDLEALAGDLRQRDMGLILDVVCNHTAREHAWAAK
ARAGDPAYRDYYIVLPDAQSAAARDRELIDVFPDTAPGSFTYDAAMGGYVWTTFYPFQWD
LNYANPAVFAEMLEVLIFLAAKGAQGFRLDSAPFLWKQAGTTCRNLPQTYEIVEAWRAAL
SIVAPGVVLLAEAIESVEDVLPFFGGEESGCNLAYNNVVMTALWAALADGDAVIARRCLA
VAARKPAQGAWLNYVRCHDDLIWNALAAYAPASDLRRWSNAYGNGEGFSRGRAFQTAEGG
VPSTNGMAAALAGLTADADGDCLGARRLRLLYGIIHALDGWPLIYMGDEIGLDNDEAYQD
DPLRAGDGRWLHRPQMDWSLAERRGEAGALQADLFATFARLGQRARRLATLGVAGPARPV
EVSSPAVLAFLRDEGARPFLCVANVSDAPQDFELPPAFAQGAEDVLDGAPSPAGAVSLPP
YGITWLVAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory