Comparing CCNA_01199 FitnessBrowser__Caulo:CCNA_01199 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 13:297/302 of 4b2xB
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
75% identity, 99% coverage: 2:286/289 of query aligns to 9:293/298 of 5fuhA
4b4bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 9:293/298 of 4b4bA
4asjA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 3:287/292 of 4asjA
1g3lA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tdp-l-rhamnose complex. (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 3:287/292 of 1g3lA
1g2vA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Ttp complex. (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 3:287/292 of 1g2vA
1g1lA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tdp-glucose complex. (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 3:287/292 of 1g1lA
Sites not aligning to the query:
1g0rA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Thymidine/glucose- 1-phosphate complex. (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 3:287/292 of 1g0rA
1fxoA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tmp complex. (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 3:287/292 of 1fxoA
3zllA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 8:292/297 of 3zllA
3zlkA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 8:292/297 of 3zlkA
4b4mA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 7:291/296 of 4b4mA
4arwA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 5:289/294 of 4arwA
5fu8A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
75% identity, 99% coverage: 2:286/289 of query aligns to 8:292/297 of 5fu8A
4b5bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 4:288/293 of 4b5bA
4b4gA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 4:288/293 of 4b4gA
4b42A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 4:288/293 of 4b42A
4b3uA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 10:294/299 of 4b3uA
4b2wA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 8:292/297 of 4b2wA
4asyA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
75% identity, 99% coverage: 2:286/289 of query aligns to 4:288/293 of 4asyA
>CCNA_01199 FitnessBrowser__Caulo:CCNA_01199
MKGIILAGGSGTRLHPMTLVTSKQLMPVYDKPMIYYPLSTLMLAGIREILIISTPRDTPN
FQALLGDGSQWGLDIQYAVQPSPDGLAQAYVIGADFVGRDPSALILGDNIYFGHGITNLF
TRAMARPKGATVFAYHVNDPERYGVVEFDKQMTALSIEEKPKVPKSNWAVTGLYFYDGDV
VDIARDLKPSARGELEITDVNRAYLERGDLSVELMGRGYAWLDTGTPDSLLEAAEFVRVL
EKRQGFKIACPEEVAYQKGFIDAAQVERLADALGKSAYGSYLRTVIGVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory