SitesBLAST
Comparing CCNA_01204 FitnessBrowser__Caulo:CCNA_01204 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
59% identity, 97% coverage: 4:308/315 of query aligns to 89:391/420 of Q8NBZ7
- G98 (= G13) binding
- F99 (= F14) binding
- V100 (= V15) binding
- D119 (= D34) binding
- N120 (= N35) binding
- F122 (≠ Y37) binding
- T123 (= T38) binding
- G124 (= G39) binding
- D144 (= D59) binding
- V145 (= V60) binding
- L149 (= L64) binding
- Y150 (= Y65) binding
- L159 (= L74) binding
- S161 (≠ C76) binding
- K177 (= K92) binding
- T178 (= T93) binding
- N185 (= N100) binding
- G188 (= G103) binding
- K191 (= K106) binding
- R192 (= R107) binding
- A200 (= A115) binding
- E204 (= E119) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y146) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K150) binding
- R236 (= R151) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (= Y160) binding
- Q248 (= Q163) binding
- E249 (≠ H164) binding
- T261 (= T176) binding
- H267 (= H182) binding
- R272 (= R187) binding
- R361 (= R278) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
58% identity, 98% coverage: 4:313/315 of query aligns to 87:394/418 of Q6GMI9
- R234 (= R151) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
59% identity, 97% coverage: 4:308/315 of query aligns to 2:304/312 of 2b69A
- active site: T115 (= T117), S116 (= S118), E117 (= E119), Y144 (= Y146), K148 (= K150), R185 (= R187)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), V13 (= V15), D32 (= D34), N33 (= N35), T36 (= T38), G37 (= G39), D57 (= D59), V58 (= V60), L72 (= L74), A73 (= A75), S74 (≠ C76), A76 (= A78), T91 (= T93), T115 (= T117), Y144 (= Y146), K148 (= K150), I171 (= I173), N173 (= N175), R185 (= R187)
- binding uridine-5'-diphosphate: P61 (= P63), L62 (= L64), Y63 (= Y65), P78 (= P80), N98 (= N100), G101 (= G103), L102 (= L104), K104 (= K106), R105 (= R107), Y158 (= Y160), N173 (= N175), R185 (= R187), V186 (= V188), N189 (= N191), T201 (= T203), Y203 (= Y205), Q208 (= Q210), R210 (= R212), I244 (≠ M248), D270 (= D274)
4lk3B Crystal structure of human udp-xylose synthase r236a substitution (see paper)
51% identity, 97% coverage: 4:308/315 of query aligns to 2:266/274 of 4lk3B
- active site: T112 (= T117), S113 (= S118), E114 (= E119), K119 (= K150), R156 (= R187)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), V13 (= V15), D32 (= D34), N33 (= N35), T36 (= T38), G37 (= G39), D57 (= D59), V58 (= V60), L72 (= L74), A73 (= A75), S74 (≠ C76), P75 (= P77), T88 (= T93), A110 (= A115), T112 (= T117), K119 (= K150), I142 (= I173), H151 (= H182)
- binding uridine-5'-diphosphate: R156 (= R187), V157 (= V188), N160 (= N191), T172 (= T203), Y174 (= Y205), Q179 (= Q210), R181 (= R212), I215 (≠ M248)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P63), L62 (= L64), Y63 (= Y65), I83 (≠ V88), K87 (= K92), N95 (= N100), G98 (= G103), L99 (= L104), K101 (= K106), Y129 (= Y160), E133 (≠ H164)
4lk3C Crystal structure of human udp-xylose synthase r236a substitution (see paper)
50% identity, 97% coverage: 4:308/315 of query aligns to 2:263/271 of 4lk3C
- active site: T110 (= T117), S111 (= S118), E112 (= E119), K117 (= K150), R154 (= R187)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), V13 (= V15), D32 (= D34), N33 (= N35), T36 (= T38), G37 (= G39), D57 (= D59), V58 (= V60), L72 (= L74), A73 (= A75), S74 (≠ C76), P75 (= P77), T86 (= T93), K117 (= K150), I140 (= I173), H149 (= H182)
- binding pyrophosphate 2-: R154 (= R187), V155 (= V188)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P63), L62 (= L64), Y63 (= Y65), N93 (= N100), G96 (= G103), L97 (= L104), K99 (= K106), R100 (= R107), Y127 (= Y160), E131 (≠ H164)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
33% identity, 98% coverage: 6:313/315 of query aligns to 3:309/309 of 4zrnA
- active site: T117 (≠ S116), G119 (≠ S118), A120 (≠ E119), Y143 (= Y146), K147 (= K150), Y181 (vs. gap), G185 (≠ R187)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (= D34), N32 (= N35), S34 (≠ Y37), S35 (≠ T38), G36 (= G39), S51 (= S49), I52 (≠ N50), L73 (= L74), A74 (= A75), A75 (≠ C76), T92 (= T93), S115 (≠ Q114), S116 (≠ A115), Y143 (= Y146), K147 (= K150), Y170 (≠ I173), V173 (≠ T176)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S116), G119 (≠ S118), A120 (≠ E119), Y143 (= Y146), N172 (= N175), G185 (≠ R187), V186 (= V188), H201 (≠ T203), F203 (≠ Y205), Y208 (≠ Q210), R210 (= R212), V244 (≠ M248), R267 (≠ P271), D270 (= D274)
4m55E Crystal structure of human udp-xylose synthase r236h substitution (see paper)
38% identity, 75% coverage: 5:240/315 of query aligns to 1:156/164 of 4m55E
- active site: T105 (= T117)
- binding nicotinamide-adenine-dinucleotide: G6 (= G10), G9 (= G13), F10 (= F14), V11 (= V15), D30 (= D34), N31 (= N35), F32 (≠ Y36), T34 (= T38), G35 (= G39), D55 (= D59), V56 (= V60), S72 (≠ C76), P73 (= P77), T81 (= T93), T105 (= T117), T131 (= T176)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
30% identity, 98% coverage: 5:314/315 of query aligns to 2:316/321 of 6zllA
- active site: T126 (= T117), S127 (= S118), S128 (≠ E119), Y149 (= Y146), K153 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (= D34), H33 (≠ N35), F34 (≠ Y36), I35 (≠ Y37), K43 (≠ S40), D62 (= D59), I63 (≠ V60), L81 (= L74), A82 (= A75), A83 (≠ C76), I124 (≠ A115), T126 (= T117), Y149 (= Y146), K153 (= K150), Y176 (≠ I173), V179 (≠ T176), R185 (≠ H182), M188 (≠ R187)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (= P77), V87 (≠ S79), R88 (≠ P80), T126 (= T117), S127 (= S118), Y149 (= Y146), T178 (≠ N175), R185 (≠ H182), A189 (≠ V188), R192 (≠ N191), T204 (= T203), F206 (≠ Y205), Q211 (= Q210), R213 (= R212), I250 (≠ M248), E276 (≠ D274)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
30% identity, 97% coverage: 5:311/315 of query aligns to 2:313/314 of 6zldA
- active site: T126 (= T117), S127 (= S118), S128 (≠ E119), Y149 (= Y146), K153 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (= D34), H33 (≠ N35), F34 (≠ Y36), I35 (≠ Y37), K43 (≠ S40), D62 (= D59), I63 (≠ V60), L81 (= L74), A82 (= A75), A83 (≠ C76), I124 (≠ A115), T126 (= T117), K153 (= K150), Y176 (≠ I173), T178 (≠ N175), R185 (≠ H182), M188 (≠ R187)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (= P77), R88 (≠ P80), T126 (= T117), S127 (= S118), S128 (≠ E119), Y149 (= Y146), F177 (= F174), T178 (≠ N175), R185 (≠ H182), M188 (≠ R187), A189 (≠ V188), R192 (≠ N191), T204 (= T203), F206 (≠ Y205), Q211 (= Q210), R213 (= R212), I250 (≠ M248), E276 (≠ D274)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
30% identity, 97% coverage: 5:311/315 of query aligns to 2:313/314 of 6zl6A
- active site: T126 (= T117), S127 (= S118), S128 (≠ E119), Y149 (= Y146), K153 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (= D34), H33 (≠ N35), F34 (≠ Y36), I35 (≠ Y37), K43 (≠ S40), D62 (= D59), I63 (≠ V60), L81 (= L74), A82 (= A75), A83 (≠ C76), I124 (≠ A115), T126 (= T117), K153 (= K150), Y176 (≠ I173), T178 (≠ N175), V179 (≠ T176), R185 (≠ H182), M188 (≠ R187)
- binding uridine-5'-diphosphate: T178 (≠ N175), A189 (≠ V188), R192 (≠ N191), T204 (= T203), F206 (≠ Y205), Q211 (= Q210), R213 (= R212), I250 (≠ M248), E276 (≠ D274)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
30% identity, 97% coverage: 5:311/315 of query aligns to 2:313/314 of 6zljA
- active site: T126 (= T117), S127 (= S118), S128 (≠ E119), F149 (≠ Y146), K153 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (= D34), H33 (≠ N35), F34 (≠ Y36), I35 (≠ Y37), K43 (≠ S40), D62 (= D59), I63 (≠ V60), L81 (= L74), A82 (= A75), A83 (≠ C76), I124 (≠ A115), T126 (= T117), K153 (= K150), Y176 (≠ I173), T178 (≠ N175), V179 (≠ T176), R185 (≠ H182), M188 (≠ R187)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (= P77), R88 (≠ P80), T126 (= T117), S127 (= S118), S128 (≠ E119), F149 (≠ Y146), F177 (= F174), T178 (≠ N175), R185 (≠ H182), M188 (≠ R187), A189 (≠ V188), R192 (≠ N191), T204 (= T203), F206 (≠ Y205), Q211 (= Q210), R213 (= R212), I250 (≠ M248), E276 (≠ D274)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
29% identity, 97% coverage: 4:310/315 of query aligns to 8:313/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G10), G17 (= G13), F18 (= F14), I19 (≠ V15), D37 (= D34), N38 (= N35), E40 (≠ Y37), R41 (≠ T38), N61 (≠ E54), V62 (≠ L55), A81 (≠ L74), A82 (= A75), A83 (≠ C76), F124 (≠ A115), K154 (= K150), P177 (≠ I173), N179 (= N175)
- binding uridine-5'-diphosphate: R147 (= R143), G189 (= G186), A190 (≠ V188), M194 (≠ F192), Y205 (≠ T203), I206 (≠ L204), F207 (≠ Y205), R214 (= R212), I251 (≠ M248)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
29% identity, 97% coverage: 5:311/315 of query aligns to 2:312/313 of 6bwlA
- active site: T122 (= T117), C123 (≠ S118), M124 (≠ E119), Y147 (= Y146), K151 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (= D34), N32 (= N35), L33 (≠ Y36), N35 (≠ T38), S36 (≠ G39), D57 (= D59), I58 (≠ V60), L79 (= L74), A80 (= A75), A81 (≠ C76), I83 (≠ A78), M120 (≠ A115), K151 (= K150), N176 (= N175), T177 (= T176)
- binding uridine-5'-diphosphate: N176 (= N175), G189 (≠ R187), V190 (= V188), N205 (≠ T203), I206 (≠ L204), Y207 (= Y205), Q212 (= Q210), R214 (= R212), I250 (≠ M248), E275 (≠ D274)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
29% identity, 96% coverage: 6:308/315 of query aligns to 18:323/336 of 6pnlA
- active site: S133 (= S116), C135 (≠ S118), G136 (≠ E119), Y159 (= Y146), K163 (= K150)
- binding nicotinamide-adenine-dinucleotide: G22 (= G10), G25 (= G13), C26 (≠ F14), D46 (= D34), N47 (= N35), L48 (≠ Y36), S49 (≠ Y37), S50 (≠ T38), S51 (≠ G39), D68 (≠ E54), I69 (≠ L55), L89 (= L74), A91 (≠ C76), F93 (≠ A78), V108 (≠ T93), S131 (≠ Q114), S133 (= S116), Y159 (= Y146), K163 (= K150), F186 (≠ I173), N188 (= N175), V189 (≠ T176), R200 (= R187)
- binding uridine-5'-diphosphate: N188 (= N175), N201 (vs. gap), V202 (= V188), F206 (= F192), P217 (≠ T203), I218 (≠ L204), T219 (≠ Y205), R226 (= R212), V262 (≠ M248), R285 (≠ P271)
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
29% identity, 96% coverage: 6:308/315 of query aligns to 12:317/330 of 6pmhA
- active site: S127 (= S116), C129 (≠ S118), G130 (≠ E119), Y153 (= Y146), K157 (= K150)
- binding adenosine monophosphate: G16 (= G10), G19 (= G13), D40 (= D34), N41 (= N35), S43 (≠ Y37), S44 (≠ T38), S45 (≠ G39), D62 (≠ E54), I63 (≠ L55), A84 (= A75), F87 (≠ A78), R194 (= R187)
- binding uridine-5'-diphosphate: C129 (≠ S118), N182 (= N175), N195 (vs. gap), V196 (= V188), F200 (= F192), P211 (≠ T203), I212 (≠ L204), T213 (≠ Y205), R220 (= R212), V256 (≠ M248), R279 (≠ P271)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
31% identity, 96% coverage: 3:303/315 of query aligns to 1:303/308 of 6wj9B
- active site: A119 (≠ T117), A120 (≠ S118), A121 (≠ E119), F144 (≠ Y146), K148 (= K150)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), I13 (≠ V15), D32 (= D34), D33 (≠ N35), S35 (≠ Y37), T36 (= T38), G37 (= G39), D55 (= D59), A56 (≠ V60), L75 (= L74), A76 (= A75), A77 (≠ C76), S94 (≠ T93), A117 (= A115), A119 (≠ T117), F144 (≠ Y146), K148 (= K150), F171 (≠ I173), F172 (= F174), I174 (≠ T176)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ P80), N173 (= N175), G187 (≠ R187), V188 (= V188), F192 (= F192), T203 (= T203), L204 (= L204), F205 (≠ Y205), R212 (= R212), L248 (≠ M248), R271 (≠ P271), D274 (= D274)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
31% identity, 95% coverage: 4:303/315 of query aligns to 1:302/307 of 6wjaA
- active site: A118 (≠ T117), A119 (≠ S118), A120 (≠ E119), F143 (≠ Y146), K147 (= K150)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (= D34), D32 (≠ N35), S34 (≠ Y37), T35 (= T38), G36 (= G39), A55 (≠ V60), L74 (= L74), A75 (= A75), A76 (≠ C76), S93 (≠ T93), F143 (≠ Y146), K147 (= K150), F170 (≠ I173), F171 (= F174), I173 (≠ T176)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ P80), A120 (≠ E119), N172 (= N175), G186 (≠ R187), V187 (= V188), F191 (= F192), T202 (= T203), F204 (≠ Y205), R211 (= R212), L247 (≠ M248), R270 (≠ P271), D273 (= D274)
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
29% identity, 97% coverage: 7:313/315 of query aligns to 20:336/336 of 3ruhA
- active site: S142 (≠ T117), S143 (= S118), S144 (≠ E119), Y166 (= Y146), K170 (= K150), N204 (= N184)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (≠ V15), D47 (= D34), N48 (= N35), S50 (≠ Y37), T51 (= T38), G52 (= G39), D78 (= D59), I79 (≠ V60), Q98 (≠ L74), A99 (= A75), A100 (≠ C76), T117 (= T93), A140 (= A115), A141 (≠ S116), S142 (≠ T117), Y166 (= Y146), K170 (= K150), Y193 (≠ I173), V196 (≠ T176)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A78), S103 (= S79), S142 (≠ T117), S143 (= S118), S144 (≠ E119), Y166 (= Y146), Y193 (≠ I173), N195 (= N175), A209 (≠ R187), V210 (= V188), K213 (≠ N191), W214 (≠ F192), Y225 (≠ T203), I226 (≠ L204), N227 (≠ Y205), R234 (= R212), L271 (≠ M248), R294 (≠ P271), D297 (= D274), V298 (≠ P275), S301 (≠ R278)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
29% identity, 97% coverage: 7:313/315 of query aligns to 20:336/336 of 3rufA
- active site: S142 (≠ T117), S143 (= S118), S144 (≠ E119), Y166 (= Y146), K170 (= K150), N204 (= N184)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (≠ V15), D47 (= D34), N48 (= N35), S50 (≠ Y37), T51 (= T38), G52 (= G39), D78 (= D59), I79 (≠ V60), Q98 (≠ L74), A99 (= A75), A100 (≠ C76), T117 (= T93), A140 (= A115), Y166 (= Y146), K170 (= K150), Y193 (≠ I173), V196 (≠ T176)
- binding uridine-5'-diphosphate: N195 (= N175), A209 (≠ R187), V210 (= V188), K213 (≠ N191), W214 (≠ F192), Y225 (≠ T203), I226 (≠ L204), N227 (≠ Y205), R234 (= R212), L271 (≠ M248), R294 (≠ P271), D297 (= D274)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
29% identity, 97% coverage: 7:313/315 of query aligns to 20:336/336 of 3lu1A
- active site: S142 (≠ T117), S143 (= S118), S144 (≠ E119), Y166 (= Y146), K170 (= K150), N204 (= N184)
- binding glycine: Q135 (≠ K111), K187 (≠ R167)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (≠ V15), D47 (= D34), N48 (= N35), S50 (≠ Y37), T51 (= T38), G52 (= G39), D78 (= D59), I79 (≠ V60), Q98 (≠ L74), A99 (= A75), A100 (≠ C76), A140 (= A115), A141 (≠ S116), S142 (≠ T117), Y166 (= Y146), K170 (= K150), Y193 (≠ I173), N195 (= N175)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S79), S142 (≠ T117), S143 (= S118), S144 (≠ E119), Y166 (= Y146), N195 (= N175), V210 (= V188), W214 (≠ F192), Y225 (≠ T203), I226 (≠ L204), N227 (≠ Y205), R234 (= R212), L271 (≠ M248), R294 (≠ P271), D297 (= D274)
Query Sequence
>CCNA_01204 FitnessBrowser__Caulo:CCNA_01204
MHTQRILVTGGAGFVGSHLCDRLLETGAEVLCVDNYYTGSRLNVAQNLSNPRFELLRHDV
TMPLYVEVDQIYNLACPASPVHYQFDPVQTTKTSVHGAINMLGLAKRVKAKILQASTSEV
YGDPTIHPQVESYWGNVNPIGLRSCYDEGKRCAETLFFDYWRQHKLRIKVARIFNTYGPR
MHPNDGRVVSNFIVQALKGEDITLYGDGNQTRSFCYVDDLVDGLIRLMKTGDEVTGPINL
GNPVEFTMKQLAELVLELTGSQSTIVHRPLPSDDPRQRQPDITLAKQVLDWTPTAPLKVG
LMKTIEYFDGLLKAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory