SitesBLAST
Comparing CCNA_01283 FitnessBrowser__Caulo:CCNA_01283 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
100% identity, 84% coverage: 63:398/398 of query aligns to 1:336/336 of 5a06A
- active site: K101 (= K163), Y186 (= Y248)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (= L73), G12 (= G74), Y13 (= Y75), Y14 (= Y76), S36 (= S98), G37 (= G99), T38 (= T100), K41 (= K103), Y59 (= Y121), I77 (= I139), T78 (= T140), P79 (= P141), N80 (= N142), L82 (= L144), H83 (= H145), E100 (= E162), K101 (= K163), R129 (= R191), W168 (= W230), R169 (= R231), Y186 (= Y248), Y264 (= Y326)
- binding sorbitol: R2 (= R64), D72 (= D134), H96 (= H158), K101 (= K163), R122 (= R184), R122 (= R184), L124 (= L186), F160 (= F222), R169 (= R231), D182 (= D244), Y186 (= Y248), K287 (= K349), H296 (= H358), E299 (= E361), E306 (= E368), G310 (= G372), G311 (= G373)
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
100% identity, 84% coverage: 63:398/398 of query aligns to 1:336/336 of 5a03C
- active site: K101 (= K163), Y186 (= Y248)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G72), L11 (= L73), G12 (= G74), Y13 (= Y75), Y14 (= Y76), S36 (= S98), G37 (= G99), T38 (= T100), K41 (= K103), Y59 (= Y121), I77 (= I139), T78 (= T140), P79 (= P141), N80 (= N142), L82 (= L144), H83 (= H145), E100 (= E162), K101 (= K163), R129 (= R191), W168 (= W230), R169 (= R231), Y186 (= Y248), Y264 (= Y326)
- binding beta-D-xylopyranose: K101 (= K163), F160 (= F222), R169 (= R231), D182 (= D244), Y186 (= Y248)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
100% identity, 84% coverage: 64:398/398 of query aligns to 1:335/335 of 5a05A
- active site: K100 (= K163), Y185 (= Y248)
- binding beta-D-glucopyranose: K100 (= K163), F159 (= F222), D181 (= D244), Y185 (= Y248)
- binding alpha-D-glucopyranose: P259 (= P322), S262 (= S325)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G72), L10 (= L73), G11 (= G74), Y12 (= Y75), Y13 (= Y76), S35 (= S98), G36 (= G99), T37 (= T100), K40 (= K103), Y58 (= Y121), I76 (= I139), T77 (= T140), P78 (= P141), N79 (= N142), L81 (= L144), H82 (= H145), E99 (= E162), K100 (= K163), R128 (= R191), W167 (= W230), R168 (= R231), Y185 (= Y248), Y263 (= Y326)
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
100% identity, 84% coverage: 64:398/398 of query aligns to 1:335/335 of 5a04A
- active site: K100 (= K163), Y185 (= Y248)
- binding beta-D-glucopyranose: K100 (= K163), F159 (= F222), R168 (= R231), D181 (= D244), Y185 (= Y248)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (= L73), G11 (= G74), Y12 (= Y75), Y13 (= Y76), S35 (= S98), G36 (= G99), T37 (= T100), K40 (= K103), Y58 (= Y121), I76 (= I139), T77 (= T140), P78 (= P141), N79 (= N142), L81 (= L144), H82 (= H145), E99 (= E162), K100 (= K163), R128 (= R191), W167 (= W230), R168 (= R231), Y185 (= Y248), Y263 (= Y326)
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
100% identity, 84% coverage: 64:398/398 of query aligns to 1:335/335 of 5a03E
- active site: K100 (= K163), Y185 (= Y248)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G72), L10 (= L73), G11 (= G74), Y12 (= Y75), Y13 (= Y76), S35 (= S98), G36 (= G99), T37 (= T100), K40 (= K103), Y58 (= Y121), I76 (= I139), T77 (= T140), P78 (= P141), N79 (= N142), H82 (= H145), E99 (= E162), K100 (= K163), R128 (= R191), W167 (= W230), R168 (= R231), Y185 (= Y248), Y263 (= Y326)
- binding beta-D-xylopyranose: K100 (= K163), F159 (= F222), R168 (= R231), D181 (= D244), Y185 (= Y248), E205 (= E268), T207 (= T270), R209 (= R272)
- binding alpha-D-xylopyranose: H134 (= H197), M268 (= M331), R279 (= R342), E280 (= E343)
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
100% identity, 84% coverage: 64:398/398 of query aligns to 1:335/335 of 5a02A
- active site: K100 (= K163), Y185 (= Y248)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (= L73), G11 (= G74), Y12 (= Y75), Y13 (= Y76), S35 (= S98), G36 (= G99), T37 (= T100), K40 (= K103), Y58 (= Y121), I76 (= I139), T77 (= T140), P78 (= P141), L81 (= L144), H82 (= H145), E99 (= E162), K100 (= K163), R128 (= R191), W167 (= W230), R168 (= R231), Y185 (= Y248), Y263 (= Y326)
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
48% identity, 89% coverage: 43:397/398 of query aligns to 2:372/383 of 1h6dA
- active site: K131 (= K163), Y219 (= Y248)
- binding glycerol: K131 (= K163), R202 (= R231), D215 (= D244), Y219 (= Y248)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A17 (vs. gap), G18 (vs. gap), R19 (vs. gap), G40 (= G72), L41 (= L73), G42 (= G74), K43 (≠ Y75), Y44 (= Y76), S66 (= S98), G67 (= G99), K71 (= K103), Y89 (= Y121), I107 (= I139), L108 (≠ T140), P109 (= P141), N110 (= N142), H113 (= H145), E130 (= E162), K131 (= K163), R159 (= R191), A198 (vs. gap), W201 (= W230), R202 (= R231), Y219 (= Y248), Y298 (= Y326)
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
49% identity, 84% coverage: 64:397/398 of query aligns to 30:370/381 of 1rydA
- active site: K129 (= K163), Y217 (= Y248)
- binding alpha-D-glucopyranose: Y236 (≠ V267), I254 (≠ N285), Q256 (= Q287)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (= L73), G40 (= G74), K41 (≠ Y75), Y42 (= Y76), S64 (= S98), G65 (= G99), K69 (= K103), Y87 (= Y121), L106 (≠ T140), P107 (= P141), N108 (= N142), L110 (= L144), H111 (= H145), E128 (= E162), K129 (= K163), R157 (= R191), A196 (vs. gap), W199 (= W230), R200 (= R231), Y217 (= Y248), Y296 (= Y326)
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
49% identity, 84% coverage: 64:397/398 of query aligns to 1:329/340 of 1evjA
- active site: K100 (= K163), Y188 (= Y248)
- binding nicotinamide-adenine-dinucleotide: G9 (= G72), L10 (= L73), G11 (= G74), K12 (≠ Y75), Y13 (= Y76), D35 (≠ S98), L77 (≠ T140), P78 (= P141), N79 (= N142), H82 (= H145), E99 (= E162), K100 (= K163), R128 (= R191), W170 (= W230), R171 (= R231), Y188 (= Y248), Y267 (= Y326)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
27% identity, 77% coverage: 92:398/398 of query aligns to 26:328/332 of 2glxA
- active site: K93 (= K163), H179 (≠ Y248)
- binding acetate ion: K93 (= K163), H179 (≠ Y248)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S32 (= S98), T33 (≠ G99), R37 (≠ K103), S69 (≠ I139), T70 (= T140), N72 (= N142), H75 (= H145), E92 (= E162), K93 (= K163), H121 (≠ R191), W161 (= W230), R162 (= R231), Y282 (≠ F352)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
27% identity, 77% coverage: 92:398/398 of query aligns to 27:329/333 of Q2I8V6
- S33 (= S98) mutation to D: No activity.
- ST 33:34 (≠ SG 98:99) binding
- R38 (≠ K103) binding
- TTNELH 71:76 (≠ TPNSLH 140:145) binding
- EK 93:94 (= EK 162:163) binding
- K94 (= K163) mutation to G: Less than 1% remaining activity.
- N120 (≠ G189) binding
- WR 162:163 (= WR 230:231) binding
- D176 (= D244) mutation to A: Less than 1% remaining activity.
- H180 (≠ Y248) mutation to A: Less than 2% remaining activity.
- G206 (≠ D274) mutation to I: No effect.
- Y283 (≠ F352) binding
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
P39353 2,7-anhydro-N-acetylneuraminate hydratase; EcNanOx; EC 4.2.1.- from Escherichia coli (strain K12) (see paper)
30% identity, 64% coverage: 66:321/398 of query aligns to 2:252/372 of P39353
- Y11 (= Y75) binding
- F12 (≠ Y76) binding
- D33 (≠ T100) binding
- N36 (≠ K103) binding
- T68 (= T140) binding
- N70 (= N142) binding
- H73 (= H145) binding
- E90 (= E162) binding
- K91 (= K163) binding
- W160 (= W230) binding
6o15A Crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with NAD(h) (see paper)
30% identity, 64% coverage: 66:321/398 of query aligns to 2:252/355 of 6o15A
- binding nicotinamide-adenine-dinucleotide: G10 (= G74), Y11 (= Y75), F12 (≠ Y76), Y32 (≠ G99), D33 (≠ T100), A67 (≠ I139), T68 (= T140), P69 (= P141), N70 (= N142), H73 (= H145), E90 (= E162), K91 (= K163), I119 (≠ R191), W160 (= W230)
7xr9A Crystal structure of dgpa with glucose (see paper)
27% identity, 69% coverage: 124:398/398 of query aligns to 52:344/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K163), R150 (vs. gap), W157 (≠ D219), F160 (= F222), D173 (= D244), H177 (≠ Y248)
- binding nicotinamide-adenine-dinucleotide: Y52 (≠ F124), C67 (≠ I139), T68 (= T140), P69 (= P141), H73 (= H145), E90 (= E162), K91 (= K163), P92 (= P164), Q119 (≠ R191), V159 (≠ G221), F160 (= F222), Q166 (≠ A237)
Sites not aligning to the query:
7xreC Crystal structure of dgpa (see paper)
27% identity, 69% coverage: 124:398/398 of query aligns to 62:363/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: T78 (= T140), P79 (= P141), N80 (= N142), H83 (= H145), E100 (= E162), K101 (= K163), P102 (= P164), F170 (= F222), Q176 (≠ A237), H187 (≠ Y248), Y313 (≠ E343), F314 (≠ P344)
Sites not aligning to the query:
3e18A Crystal structure of NAD-binding protein from listeria innocua
28% identity, 69% coverage: 121:396/398 of query aligns to 52:346/348 of 3e18A
- active site: K94 (= K163), H178 (≠ Y248)
- binding nicotinamide-adenine-dinucleotide: A70 (≠ I139), T71 (= T140), P72 (= P141), N73 (= N142), H76 (= H145), E93 (= E162), K94 (= K163), N122 (≠ R191), W161 (= W230), R162 (= R231), H178 (≠ Y248)
Sites not aligning to the query:
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
35% identity, 45% coverage: 118:298/398 of query aligns to 53:250/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: T79 (= T140), P80 (= P141), N81 (= N142), H84 (= H145), E101 (= E162), K102 (= K163), W173 (= W230), R174 (= R231)
- binding alpha-L-sorbopyranose: K102 (= K163), Y131 (≠ S192), Y159 (≠ V216), Q161 (≠ T218), W163 (≠ H220), R174 (= R231), D187 (= D244)
Sites not aligning to the query:
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
26% identity, 81% coverage: 70:392/398 of query aligns to 14:328/332 of B3TMR8
- 17:23 (vs. 73:79, 29% identical) binding
- SR 42:43 (≠ SG 98:99) binding
- Y63 (≠ F124) binding
- L79 (≠ T140) binding
- H84 (= H145) binding
- K102 (= K163) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (≠ N233) binding
- D182 (= D244) binding
- Y186 (= Y248) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
26% identity, 81% coverage: 70:392/398 of query aligns to 7:321/325 of 3rc1A
- active site: K95 (= K163), Y179 (= Y248)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ L73), A11 (≠ G74), D12 (≠ Y75), I13 (≠ Y76), S35 (= S98), R36 (≠ G99), Y56 (≠ F124), P71 (≠ I139), L72 (≠ T140), P73 (= P141), H77 (= H145), E94 (= E162), K95 (= K163), I162 (≠ L232), R163 (≠ N233), V168 (≠ A237), D175 (= D244), Y179 (= Y248)
- binding phosphate ion: H278 (≠ K349), K283 (≠ A354)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (= R79), R17 (≠ I80), F152 (= F222), I154 (= I224), P155 (≠ G225), Y233 (= Y302), T253 (≠ D321)
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
37% identity, 38% coverage: 118:270/398 of query aligns to 54:213/372 of 6a3iA
- binding Levoglucosan: K103 (= K163), Y132 (≠ S192), Y160 (≠ V216), Q162 (≠ T218), R175 (= R231), D188 (= D244), H192 (≠ Y248)
- binding 1,4-dihydronicotinamide adenine dinucleotide: P81 (= P141), N82 (= N142), L84 (= L144), H85 (= H145), E102 (= E162), K103 (= K163), W174 (= W230), R175 (= R231)
Sites not aligning to the query:
Query Sequence
>CCNA_01283 FitnessBrowser__Caulo:CCNA_01283
MRIRRGRRDAVHHLQPSRGAGAHQDQRAGALAMETISKRSLLAAGLAAGVAGLPRGAFAA
QPGRKLGYAILGLGYYATRIIMPRFAECEHSRLAALVSGTPEKLKTYGEQYGIPETHRYS
YETFDRIIDNPDVDIVYVITPNSLHRPFTERAARAGKHVMCEKPMANTVADCEAMIAACK
KAGRKLMIGYRSRFQAHNIEAIKLVRDGALGPVRTVVTDHGFTIGDPKQWRLNRALAGGG
SLMDIGIYSLNAARYLTGEEPVAVNAVESTDRSDPRFGEVEDIINFQLLFPSGATANCVS
AYSVNCNRYRVSGPKGWVEIDPATSYQGQAMRAQLGGPPAPREPAPQPKNQFSAQLDHLS
ECILTGREPIVGGDDGLKDLRVIEAIYRAAREGRTVKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory