SitesBLAST
Comparing CCNA_01354 FitnessBrowser__Caulo:CCNA_01354 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
31% identity, 95% coverage: 4:315/328 of query aligns to 5:329/340 of 4n54A
- active site: K96 (= K92), H183 (= H173)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R11), K96 (= K92), D156 (= D151), D179 (= D169), M180 (= M170), H183 (= H173), R238 (= R228), Y244 (= Y234)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ L7), G9 (= G8), L10 (≠ A9), G11 (= G10), R12 (= R11), L13 (≠ I12), S35 (≠ D33), V36 (≠ P34), E40 (≠ A38), S73 (= S69), P74 (≠ S70), F77 (≠ T73), H78 (= H74), E95 (= E91), K96 (= K92), M125 (≠ N120), F167 (≠ V162), F284 (= F274)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
26% identity, 99% coverage: 5:328/328 of query aligns to 8:340/342 of 3ceaA
- active site: K98 (= K92), H185 (= H173)
- binding nicotinamide-adenine-dinucleotide: G11 (= G8), G13 (= G10), R14 (= R11), L15 (≠ I12), L38 (vs. gap), Q42 (≠ P34), V74 (≠ A68), A75 (≠ S69), P76 (≠ S70), T77 (= T71), F79 (≠ T73), H80 (= H74), M83 (≠ Y77), E97 (= E91), K98 (= K92), M127 (≠ N120), F169 (≠ V162), H185 (= H173), F286 (= F273)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
29% identity, 98% coverage: 6:328/328 of query aligns to 7:328/336 of 3ec7A
- active site: K97 (= K92), H176 (= H173)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), M12 (≠ R11), I13 (= I12), D35 (= D33), I36 (≠ P34), R40 (vs. gap), T73 (≠ A68), A74 (≠ S69), S75 (= S70), N76 (≠ T71), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ N120), W271 (vs. gap), Y279 (= Y282)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
27% identity, 86% coverage: 47:328/328 of query aligns to 48:328/332 of 2glxA
- active site: K93 (= K92), H179 (= H173)
- binding acetate ion: K93 (= K92), H179 (= H173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S69 (≠ A68), T70 (≠ S69), N72 (≠ T71), H75 (= H74), E92 (= E91), K93 (= K92), H121 (≠ N120), W161 (≠ V160), R162 (≠ K161), Y282 (= Y282)
Sites not aligning to the query:
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
27% identity, 91% coverage: 4:302/328 of query aligns to 5:301/339 of 4mjlD
- active site: K97 (= K92)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K92), H155 (= H150), N157 (≠ P154), D172 (= D169), T173 (≠ M170), H176 (= H173), Y236 (= Y234)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), A12 (≠ R11), M13 (≠ I12), D35 (≠ V31), I36 (≠ V32), V73 (≠ A68), S74 (= S69), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ N120), D172 (= D169), W274 (≠ F274), Y282 (= Y282)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
27% identity, 91% coverage: 4:302/328 of query aligns to 5:301/339 of 4mioD
- active site: K97 (= K92)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K92), H155 (= H150), N157 (≠ P154), D172 (= D169), T173 (≠ M170), H176 (= H173), Y236 (= Y234)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R11), M13 (≠ I12), D35 (≠ V31), I36 (≠ V32), S74 (= S69), A78 (≠ T73), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ N120), D172 (= D169), W274 (≠ F274), Y282 (= Y282)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
27% identity, 91% coverage: 4:302/328 of query aligns to 5:301/339 of 4mioA
- active site: K97 (= K92)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), A12 (≠ R11), M13 (≠ I12), D35 (≠ V31), I36 (≠ V32), S74 (= S69), F75 (≠ S70), H79 (= H74), E96 (= E91), K97 (= K92), W274 (≠ F274), Y282 (= Y282)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
27% identity, 91% coverage: 4:302/328 of query aligns to 5:301/339 of 4minA
- active site: K97 (= K92)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), A12 (≠ R11), M13 (≠ I12), D35 (≠ V31), I36 (≠ V32), V73 (≠ A68), S74 (= S69), F75 (≠ S70), H79 (= H74), E96 (= E91), K97 (= K92), Y282 (= Y282)
6norA Crystal structure of gend2 from gentamicin a biosynthesis in complex with NAD (see paper)
31% identity, 72% coverage: 16:250/328 of query aligns to 27:263/349 of 6norA
- binding nicotinamide-adenine-dinucleotide: D44 (= D33), R45 (≠ P34), A80 (= A68), T81 (≠ S69), P82 (≠ S70), H86 (= H74), E103 (= E91), K104 (= K92), N132 (= N120), T169 (≠ V157), W171 (≠ Y159)
Sites not aligning to the query:
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
26% identity, 99% coverage: 4:328/328 of query aligns to 5:327/337 of 3nt5A
- active site: K97 (= K92), H176 (= H173)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K92), H155 (≠ S149), H176 (= H173), Y235 (= Y234)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (≠ P34), S74 (= S69), W75 (≠ S70), G76 (≠ T71), E96 (= E91), K97 (= K92), Y280 (= Y282)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
26% identity, 99% coverage: 4:328/328 of query aligns to 5:327/337 of 3nt4A
- active site: K97 (= K92), H176 (= H173)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ S149), H176 (= H173), Y235 (= Y234), W272 (≠ F274)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (≠ P34), S74 (= S69), W75 (≠ S70), G76 (≠ T71), E96 (= E91), K97 (= K92), H176 (= H173)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
26% identity, 99% coverage: 4:328/328 of query aligns to 5:327/337 of 3nt2B
- active site: K97 (= K92), H176 (= H173)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), D35 (= D33), V36 (≠ P34), S74 (= S69), W75 (≠ S70), A78 (≠ T73), K97 (= K92), W272 (≠ F274), Y280 (= Y282)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
26% identity, 99% coverage: 4:328/328 of query aligns to 5:327/337 of 3nt2A
- active site: K97 (= K92), H176 (= H173)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (≠ P34), S74 (= S69), W75 (≠ S70), G76 (≠ T71), A78 (≠ T73), H79 (= H74), E96 (= E91), K97 (= K92), H176 (= H173), Y280 (= Y282)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
25% identity, 99% coverage: 4:328/328 of query aligns to 5:327/337 of 4l8vA
- active site: K97 (= K92), H176 (= H173)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R11), I13 (= I12), S74 (= S69), W75 (≠ S70), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ N120), W272 (≠ F274), Y280 (= Y282)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
27% identity, 86% coverage: 47:328/328 of query aligns to 49:329/333 of Q2I8V6
- TTNELH 71:76 (≠ SSTDTH 69:74) binding
- EK 93:94 (= EK 91:92) binding
- K94 (= K92) mutation to G: Less than 1% remaining activity.
- N120 (≠ G118) binding
- WR 162:163 (≠ VK 160:161) binding
- D176 (= D169) mutation to A: Less than 1% remaining activity.
- H180 (= H173) mutation to A: Less than 2% remaining activity.
- G206 (= G202) mutation to I: No effect.
- Y283 (= Y282) binding
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 33 S→D: No activity.
- 33:34 binding
- 38 binding
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
26% identity, 85% coverage: 49:328/328 of query aligns to 57:335/335 of 5a05A
- active site: K100 (= K92), Y185 (≠ H173)
- binding beta-D-glucopyranose: K100 (= K92), F159 (vs. gap), D181 (= D169), Y185 (≠ H173)
- binding alpha-D-glucopyranose: P259 (≠ N251), S262 (≠ E254)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (≠ V50), I76 (≠ A68), T77 (≠ S69), P78 (≠ S70), N79 (≠ T71), L81 (≠ T73), H82 (= H74), E99 (= E91), K100 (= K92), R128 (≠ N120), W167 (≠ P155), R168 (≠ P156), Y185 (≠ H173), Y263 (≠ S255)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
26% identity, 85% coverage: 49:328/328 of query aligns to 57:335/335 of 5a04A
- active site: K100 (= K92), Y185 (≠ H173)
- binding beta-D-glucopyranose: K100 (= K92), F159 (vs. gap), R168 (≠ P156), D181 (= D169), Y185 (≠ H173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (≠ V50), I76 (≠ A68), T77 (≠ S69), P78 (≠ S70), N79 (≠ T71), L81 (≠ T73), H82 (= H74), E99 (= E91), K100 (= K92), R128 (≠ N120), W167 (≠ P155), R168 (≠ P156), Y185 (≠ H173), Y263 (≠ S255)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 85% coverage: 49:328/328 of query aligns to 57:335/335 of 5a03E
- active site: K100 (= K92), Y185 (≠ H173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (≠ V50), I76 (≠ A68), T77 (≠ S69), P78 (≠ S70), N79 (≠ T71), H82 (= H74), E99 (= E91), K100 (= K92), R128 (≠ N120), W167 (≠ P155), R168 (≠ P156), Y185 (≠ H173), Y263 (≠ S255)
- binding beta-D-xylopyranose: K100 (= K92), F159 (vs. gap), R168 (≠ P156), D181 (= D169), Y185 (≠ H173), E205 (≠ A192), T207 (≠ S194), R209 (≠ L196)
- binding alpha-D-xylopyranose: H134 (vs. gap), M268 (vs. gap), R279 (≠ A266), E280 (≠ S267)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
26% identity, 85% coverage: 49:328/328 of query aligns to 57:335/335 of 5a02A
- active site: K100 (= K92), Y185 (≠ H173)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y58 (≠ V50), I76 (≠ A68), T77 (≠ S69), P78 (≠ S70), L81 (≠ T73), H82 (= H74), E99 (= E91), K100 (= K92), R128 (≠ N120), W167 (≠ P155), R168 (≠ P156), Y185 (≠ H173), Y263 (≠ S255)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
26% identity, 85% coverage: 49:328/328 of query aligns to 58:336/336 of 5a06A
- active site: K101 (= K92), Y186 (≠ H173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y59 (≠ V50), I77 (≠ A68), T78 (≠ S69), P79 (≠ S70), N80 (≠ T71), L82 (≠ T73), H83 (= H74), E100 (= E91), K101 (= K92), R129 (≠ N120), W168 (≠ P155), R169 (≠ P156), Y186 (≠ H173), Y264 (≠ S255)
- binding sorbitol: D72 (≠ A63), H96 (≠ A87), K101 (= K92), R122 (≠ V113), R122 (≠ V113), L124 (= L115), F160 (vs. gap), R169 (≠ P156), D182 (= D169), Y186 (≠ H173), K287 (≠ A279), H296 (= H288), E299 (= E291), E306 (≠ L298), G310 (= G302), G311 (≠ Y303)
Sites not aligning to the query:
Query Sequence
>CCNA_01354 FitnessBrowser__Caulo:CCNA_01354
MHDIAILGAGRIGRIHAKNVASQPGLRLKYVVDPVAAAADGLAGETGASVADLETALNDP
AVAGVIVASSTDTHLDYSLKAIAAGKAVFCEKPIDQDLARARSASGELGGKGVKLFLGFN
RRFDPNFQGLKARLSAGVVGALETVHITSHDPAPPPVSYVKVSGGLFKDMTIHDFDMARW
LLDEPVSEVFAAASCLVDPAIGEAGDVDTAKILLRTASGKICMISNSRRSGYGYDQRIEA
FGSKGLVRADNVMESTVSIWGENGAASDAFQNFFLDRYAEAYRREMAHFAEIIRGEALPS
VGYVDGVEALALAEAAGLSAKTGQVVKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory