Comparing CCNA_01356 FitnessBrowser__Caulo:CCNA_01356 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
28% identity, 46% coverage: 35:332/642 of query aligns to 22:305/306 of 5eynA
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
28% identity, 46% coverage: 35:332/642 of query aligns to 26:309/310 of 5yggA
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
30% identity, 51% coverage: 8:332/642 of query aligns to 2:301/301 of 1v1aA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 51% coverage: 8:333/642 of query aligns to 2:302/309 of Q53W83
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
30% identity, 50% coverage: 8:329/642 of query aligns to 2:298/300 of 1v1bA
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
26% identity, 44% coverage: 12:291/642 of query aligns to 4:254/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
26% identity, 44% coverage: 12:291/642 of query aligns to 5:255/304 of 3ih0A
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 50% coverage: 13:336/642 of query aligns to 10:311/319 of Q8ZKR2
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
28% identity, 48% coverage: 27:334/642 of query aligns to 19:307/308 of 2dcnA
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
25% identity, 51% coverage: 8:334/642 of query aligns to 1:309/311 of 2varA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
25% identity, 51% coverage: 8:334/642 of query aligns to 2:310/313 of Q97U29
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
27% identity, 50% coverage: 13:335/642 of query aligns to 6:299/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
27% identity, 50% coverage: 13:333/642 of query aligns to 6:297/297 of 1tz6A
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
25% identity, 47% coverage: 34:336/642 of query aligns to 23:321/322 of 3lkiB
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
24% identity, 50% coverage: 10:332/642 of query aligns to 4:305/308 of 3iq0B
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
26% identity, 48% coverage: 10:320/642 of query aligns to 8:306/312 of 4wjmA
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
24% identity, 51% coverage: 7:336/642 of query aligns to 1:312/312 of 3in1A
8cqxA Ribokinase from t.Sp mutant a92g
27% identity, 46% coverage: 35:332/642 of query aligns to 31:298/300 of 8cqxA
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
27% identity, 46% coverage: 40:335/642 of query aligns to 38:305/306 of 4xckA
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
29% identity, 40% coverage: 36:289/642 of query aligns to 21:237/282 of 7fcaD
>CCNA_01356 FitnessBrowser__Caulo:CCNA_01356
MAQDAKTLDLIAVGRSSVDLYGQQVGGRLEDMGSFAKYLGGSPTNTAAGGARLGLKTGLL
TRVGADHMGRFIREQLEREGVDVAGVLSDPDRLTALVILGIRDRVNFPLIFYRENCADMA
LEPSDVDEAWFAQAGAVLINGTHLSQPNVYETSLKAARAVKAAGGRVAFDIDYRPVLWGL
TGKDAGENRFVENQQVTAKLQEVVALCDLIVGTEEEIHILGGSTDTIAALRAIRRASDAL
LVCKRGPEGCVAFPGAIPDALDEGVSARGFKVEVFNVLGAGDAFMAGFLRGWLRHESVET
CCEWGNACGAIVVSRHGCTPAMPTWIELQAFLSERERPFRLREDAELEHIHWATTRERVY
DELTVLAIDHRSQFEDLIAETGGDAERIPDFKRLALRAVQMVAGRDETRFGMLLDGRFGF
EALAEAADHDYWIARPIELPKSRPLEFECSADVATELLEWPLNQVVKCLAFYHPDDESDL
RERQERQLLRLADACRKTRHELLLELILPRGMSSDSRTVARAIRRLYALGIRPDWWKLEP
LTDPDAWREIEIAIAENDPLCRGVVLLGLSAPEAELVASFEVVAPFPIVKGFAVGRTIFY
DVARAWLSNQIDDDAAVTALAAKFKVLVDAWRRLRGSVEKAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory