Comparing CCNA_01358 FitnessBrowser__Caulo:CCNA_01358 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
8bvkA The crystal structure of o-glycoside cleaving beta-eliminase from a. Tumefaciens atoge (see paper)
38% identity, 29% coverage: 125:211/299 of query aligns to 104:192/225 of 8bvkA
Sites not aligning to the query:
>CCNA_01358 FitnessBrowser__Caulo:CCNA_01358
MTIRFGVSPIAWINDDMPELGGDTPLESVLADCQAIGFEGVELGGVFPRDPAVLKPLLDR
YGLDLVGGWYSGNLLAHSAEDEIAALQPHLALLKAMGCTVFIHAETSNAIHGARDTALSA
TPRLDAEGWTLFGARLTKVADYIAAQGLKFAYHHHLGTVVERPQDLEAFLGATGPSVGLT
VDTGHAALGGVDPVALIRAHPERVAHVHCKDVRREVFQSVIGQKGGSFLDGVLAGMFTVP
GDGGLDYAAVMQALAEINYSGWIIVEAEQDPAIANPRQYGEMGLATLKKEAAATGLRAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory