Comparing CCNA_01372 FitnessBrowser__Caulo:CCNA_01372 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q5ZC82 Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG; Protein LONELY GUY; EC 3.2.2.n1 from Oryza sativa subsp. japonica (Rice) (see paper)
39% identity, 97% coverage: 7:202/202 of query aligns to 34:240/242 of Q5ZC82
P48636 Cytokinin riboside 5'-monophosphate phosphoribohydrolase; AMP nucleosidase; PaLOG; EC 3.2.2.n1; EC 3.2.2.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
43% identity, 90% coverage: 8:189/202 of query aligns to 3:185/195 of P48636
5zbkA Crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp (see paper)
43% identity, 88% coverage: 8:185/202 of query aligns to 2:180/182 of 5zbkA
5zblD Crystal structure of type-i log from corynebacterium glutamicum in complex with amp (see paper)
37% identity, 78% coverage: 8:165/202 of query aligns to 2:159/181 of 5zblD
5ajuA Crystal structure of ligand-free phosphoribohydroxylase lonely guy from claviceps purpurea in complex with phosphoribose (see paper)
37% identity, 77% coverage: 9:163/202 of query aligns to 3:181/217 of 5ajuA
O05306 Cytokinin riboside 5'-monophosphate phosphoribohydrolase; Protein LONELY GUY homolog; LOG homolog; EC 3.2.2.n1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 76% coverage: 11:163/202 of query aligns to 13:165/187 of O05306
7w2iA Crystal structure of log (rv1205) from mycobacterium tuberculosis (see paper)
42% identity, 76% coverage: 11:163/202 of query aligns to 9:161/183 of 7w2iA
3sbxA Crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp (see paper)
39% identity, 74% coverage: 11:159/202 of query aligns to 4:152/177 of 3sbxA
6y01DDD p450 cytochrome, putative (see paper)
29% identity, 66% coverage: 16:149/202 of query aligns to 11:137/166 of 6y01DDD
>CCNA_01372 FitnessBrowser__Caulo:CCNA_01372
MSDESRRLSAVCVYCGSSNDADPSYIAAAFSIGESFAKAGLKLVYGGGGVGLMGATARGA
HTAGGAVLGIIPSFLRGREQPFDDVETVVVDNMHERKMMMFERSDAFVVLPGGIGTLEEI
VELLSWRRLDLHQKPIVFHNPGGFWDPLFVLIRHTIDQGLTPPDLANAWRAVERAEDVTP
ALLAWDAEIYQSGAPDTLRRLT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory