SitesBLAST
Comparing CCNA_01375 FitnessBrowser__Caulo:CCNA_01375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
38% identity, 88% coverage: 1:128/145 of query aligns to 1:127/128 of 4mttA
1fa6A Crystal structure of the co(ii)-bound glyoxalase i of escherichia coli (see paper)
37% identity, 89% coverage: 1:129/145 of query aligns to 1:128/128 of 1fa6A
1fa5A Crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli (see paper)
37% identity, 89% coverage: 1:129/145 of query aligns to 1:128/128 of 1fa5A
P0AC81 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Escherichia coli (strain K12) (see paper)
37% identity, 89% coverage: 1:129/145 of query aligns to 1:128/135 of P0AC81
- H5 (= H5) binding
- E56 (= E62) binding
- H74 (= H80) binding in other chain
- E122 (= E123) binding in other chain
2c21A Specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme (see paper)
38% identity, 87% coverage: 2:127/145 of query aligns to 3:122/139 of 2c21A
Q9CPU0 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Mus musculus (Mouse) (see paper)
37% identity, 84% coverage: 5:126/145 of query aligns to 34:176/184 of Q9CPU0
- Q34 (≠ H5) binding
- E100 (= E62) binding
- H127 (= H80) binding in other chain
- E173 (= E123) binding in other chain
4x2aA Crystal structure of mouse glyoxalase i complexed with baicalein (see paper)
37% identity, 84% coverage: 5:126/145 of query aligns to 20:162/167 of 4x2aA
- active site: Q20 (≠ H5), E86 (= E62), H113 (= H80), E159 (= E123)
- binding 5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one: Q20 (≠ H5), F49 (≠ N34), L56 (= L41), F79 (vs. gap), E86 (= E62), H113 (= H80), M144 (= M111), E159 (= E123)
- binding zinc ion: Q20 (≠ H5), E86 (= E62), H113 (= H80), E159 (= E123)
Sites not aligning to the query:
2za0A Crystal structure of mouse glyoxalase i complexed with methyl-gerfelin (see paper)
37% identity, 84% coverage: 5:126/145 of query aligns to 31:173/180 of 2za0A
- active site: Q31 (≠ H5), E97 (= E62), H124 (= H80), E170 (= E123)
- binding methyl 4-(2,3-dihydroxy-5-methylphenoxy)-2-hydroxy-6-methylbenzoate: Q31 (≠ H5), F65 (= F39), L67 (= L41), F90 (vs. gap), E97 (= E62), H124 (= H80), M155 (= M111), E170 (= E123)
- binding zinc ion: Q31 (≠ H5), E97 (= E62), H124 (= H80), E170 (= E123)
4kykA Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
37% identity, 84% coverage: 5:126/145 of query aligns to 29:171/179 of 4kykA
4kyhA Crystal structure of mouse glyoxalase i complexed with zopolrestat (see paper)
37% identity, 84% coverage: 5:126/145 of query aligns to 29:171/177 of 4kyhA
- active site: Q29 (≠ H5), E95 (= E62), H122 (= H80), E168 (= E123)
- binding zinc ion: Q29 (≠ H5), E95 (= E62), H122 (= H80), E168 (= E123)
- binding 3,4-dihydro-4-oxo-3-((5-trifluoromethyl-2-benzothiazolyl)methyl)-1-phthalazine acetic acid: M31 (= M7), R33 (= R9), F63 (= F39), E95 (= E62), T97 (= T64), N99 (= N66)
4opnA Crystal structure of mouse glyoxalase i complexed with mah
37% identity, 84% coverage: 5:126/145 of query aligns to 26:168/172 of 4opnA
- active site: Q26 (≠ H5), E92 (= E62), H119 (= H80), E165 (= E123)
- binding L-gamma-glutamyl-N-(3-ethynylphenyl)-N-hydroxy-L-glutaminylglycine: Q26 (≠ H5), R30 (= R9), F60 (= F39), F85 (vs. gap), E92 (= E62), T94 (= T64), N96 (= N66), R115 (= R76), H119 (= H80), K143 (≠ R104), K149 (≠ H110), M150 (= M111), L153 (vs. gap), E165 (= E123)
- binding zinc ion: Q26 (≠ H5), E92 (= E62)
Sites not aligning to the query:
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
37% identity, 84% coverage: 5:126/145 of query aligns to 27:169/177 of 6l0uB
- active site: Q27 (≠ H5), E93 (= E62), H120 (= H80), E166 (= E123)
- binding N-[4-(trifluoromethyloxy)phenyl]-1,3,4,9-tetrahydropyrido[3,4-b]indole-2-carbothioamide: R116 (= R76), K144 (≠ R104), D148 (= D108), G149 (= G109), W164 (≠ S121)
- binding zinc ion: Q27 (≠ H5), E93 (= E62), H120 (= H80), E166 (= E123)
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
37% identity, 84% coverage: 5:126/145 of query aligns to 27:169/177 of 4kykB
- active site: Q27 (≠ H5), E93 (= E62), H120 (= H80), E166 (= E123)
- binding indomethacin: K144 (≠ R104), K150 (≠ H110), M151 (= M111), L154 (vs. gap), F156 (= F113)
- binding zinc ion: Q27 (≠ H5), E93 (= E62), H120 (= H80), E166 (= E123)
4pv5A Crystal structure of mouse glyoxalase i in complexed with 18-beta- glycyrrhetinic acid (see paper)
37% identity, 84% coverage: 5:126/145 of query aligns to 22:164/170 of 4pv5A
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
38% identity, 84% coverage: 5:126/145 of query aligns to 34:176/184 of Q04760
- Q34 (≠ H5) binding ; mutation to E: Reduces enzyme activity by 99%.
- S45 (= S16) mutation to A: No effect on phosphorylation.
- C61 (≠ T32) modified: Disulfide link with 139, Alternate; mutation to A: No effect on NO-mediated modification.
- S69 (≠ T40) mutation to A: No effect on phosphorylation.
- S94 (≠ A55) mutation to A: No effect on phosphorylation.
- T98 (≠ P59) mutation to A: No effect on phosphorylation.
- E100 (= E62) binding ; mutation to Q: Reduces enzyme activity by over 99%.
- T102 (= T64) mutation to A: No effect on phosphorylation.
- T107 (vs. gap) modified: Phosphothreonine; mutation to A: Loss of phosphorylation.
- E111 (= E70) to A: in dbSNP:rs4746
- H127 (= H80) binding in other chain
- C139 (= C92) modified: S-glutathionyl cysteine; alternate; modified: Disulfide link with 61, Alternate; mutation to A: Impaired NO-mediated modification. Loss of NO-mediated modification; when associated with A-19 or A-20.
- E173 (= E123) active site, Proton donor/acceptor; binding in other chain; mutation to Q: Abolishes enzyme activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 19 modified: Disulfide link with 20; C → Y: in dbSNP:rs17855424; C→A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-20. Loss of NO-mediated modification; when associated with A-139.
- 20 modified: Disulfide link with 19; C→A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-19. Loss of NO-mediated modification; when associated with A-139.
7wt0A Human glyoxalase i (with c-ter his tag) in complex with tlsc702 (see paper)
38% identity, 84% coverage: 5:126/145 of query aligns to 33:175/185 of 7wt0A
- binding (~{E})-3-(1,3-benzothiazol-2-yl)-4-(4-methoxyphenyl)but-3-enoic acid: C60 (≠ T32), F62 (≠ N34), L69 (= L41), F71 (= F43), L92 (≠ K54), E99 (= E62), H126 (= H80), K150 (≠ R104), M157 (= M111), L160 (vs. gap), F162 (= F113), E172 (= E123)
- binding zinc ion: Q33 (≠ H5), E99 (= E62), H126 (= H80), E172 (= E123)
Sites not aligning to the query:
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
38% identity, 84% coverage: 5:126/145 of query aligns to 26:168/176 of 3w0tA
- active site: Q26 (≠ H5), E92 (= E62), H119 (= H80), E165 (= E123)
- binding N-[3-(1-hydroxy-6-oxo-4-phenyl-1,6-dihydropyridin-2-yl)phenyl]methanesulfonamide: Q26 (≠ H5), F55 (≠ N34), F60 (= F39), L62 (= L41), F64 (= F43), E92 (= E62), H119 (= H80), E165 (= E123)
- binding zinc ion: Q26 (≠ H5), E92 (= E62), H119 (= H80), E165 (= E123)
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
38% identity, 84% coverage: 5:126/145 of query aligns to 26:168/176 of 3vw9A
- active site: Q26 (≠ H5), E92 (= E62), H119 (= H80), E165 (= E123)
- binding 1-hydroxy-6-[1-(3-methoxypropyl)-1H-pyrrolo[2,3-b]pyridin-5-yl]-4-phenylpyridin-2(1H)-one: Q26 (≠ H5), C53 (≠ T32), L62 (= L41), E92 (= E62), H119 (= H80), M150 (= M111), F155 (= F113), E165 (= E123)
- binding zinc ion: Q26 (≠ H5), E92 (= E62), H119 (= H80), E165 (= E123)
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
38% identity, 84% coverage: 5:126/145 of query aligns to 26:168/176 of 1qipA
- active site: Q26 (≠ H5), E92 (= E62), H119 (= H80), E165 (= E123)
- binding s-p-nitrobenzyloxycarbonylglutathione: R30 (= R9), Q51 (≠ Y30), C53 (≠ T32), F60 (= F39), F64 (= F43), I81 (≠ V50), L85 (≠ K54), T94 (= T64), N96 (= N66), R115 (= R76), M150 (= M111), F155 (= F113)
- binding zinc ion: Q26 (≠ H5), E92 (= E62), H119 (= H80), E165 (= E123)
Sites not aligning to the query:
1qinA Human glyoxalase i complexed with s-(n-hydroxy-n-p- iodophenylcarbamoyl) glutathione (see paper)
38% identity, 84% coverage: 5:126/145 of query aligns to 26:168/176 of 1qinA
- active site: Q26 (≠ H5), E92 (= E62), H119 (= H80), E165 (= E123)
- binding s-(n-hydroxy-n-iodophenylcarbamoyl)glutathione: Q26 (≠ H5), R30 (= R9), F60 (= F39), L62 (= L41), F64 (= F43), E92 (= E62), T94 (= T64), N96 (= N66), R115 (= R76), H119 (= H80), K143 (≠ R104), G148 (= G109), K149 (≠ H110), M150 (= M111), E165 (= E123)
- binding zinc ion: Q26 (≠ H5), E92 (= E62)
Sites not aligning to the query:
Query Sequence
>CCNA_01375 FitnessBrowser__Caulo:CCNA_01375
MRYLHTMIRVRDLDASLRFYCKGLGLQEMYRTENEKGRFTLVFLAAPEDVELAKARKAPL
VELTYNWDDEEYGGGRNFGHLAYRVDDIYETCQRLMDMGVTINRPPRDGHMAFVRSPDNI
SIELLQDGDLPPAEPWVSMPNVGAW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory