SitesBLAST
Comparing CCNA_01413 FitnessBrowser__Caulo:CCNA_01413 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
33% identity, 75% coverage: 2:151/199 of query aligns to 6:160/223 of P9WIC7
- R10 (= R6) mutation to A: Loss of phosphatase activity.
- H11 (= H7) active site, Tele-phosphohistidine intermediate; mutation to A: Almost completely abolished phosphatase activity.
- N17 (= N13) mutation to A: About 5% of wild-type phosphatase activity.
- K47 (≠ R46) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- R60 (= R62) mutation to A: Loss of phosphatase activity.
- H159 (= H150) mutation to A: About 5% of wild-type phosphatase activity.
Sites not aligning to the query:
- 209 L→E: Disrupts dimerization of the enzyme, which exists as a monomer and has lost its ability to perform dephosphorylation.
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
33% identity, 75% coverage: 2:151/199 of query aligns to 5:159/217 of 4pzaB
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
33% identity, 75% coverage: 2:151/199 of query aligns to 4:158/209 of 4qihA
1k6mA Crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 215:387/432 of 1k6mA
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 13, 14, 15, 16, 17, 18, 92, 120, 131, 134, 135, 136, 184, 210
1tipA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 4:176/191 of 1tipA
- active site: R8 (= R6), H9 (= H7), N15 (= N13), R58 (= R62), E78 (= E86), H143 (= H150)
- binding 6-O-phosphono-beta-D-fructofuranose: I20 (≠ L18), Y89 (≠ R97), R103 (≠ V108), K107 (≠ A112), Y118 (= Y123), R148 (= R155)
1c81A Michaelis complex of fructose-2,6-bisphosphatase
29% identity, 91% coverage: 2:183/199 of query aligns to 4:176/191 of 1c81A
- active site: R8 (= R6), H9 (= H7), N15 (= N13), R58 (= R62), E78 (= E86), H143 (= H150)
- binding 2,5-anhydro-1-deoxy-1-phosphono-6-O-phosphono-D-glucitol: R8 (= R6), H9 (= H7), N15 (= N13), I20 (≠ L18), R58 (= R62), E78 (= E86), H143 (= H150), Q144 (≠ G151), R148 (= R155)
1c80A Regulatory complex of fructose-2,6-bisphosphatase
29% identity, 91% coverage: 2:183/199 of query aligns to 4:176/191 of 1c80A
- active site: R8 (= R6), H9 (= H7), N15 (= N13), R58 (= R62), E78 (= E86), H143 (= H150)
- binding guanosine-5'-triphosphate: I20 (≠ L18), E78 (= E86), I79 (= I87), Y89 (≠ R97), F100 (vs. gap), R103 (≠ V108), Y112 (≠ A117), Y118 (= Y123), Q144 (≠ G151), A145 (≠ V152), R148 (= R155)
1c7zA Regulatory complex of fructose-2,6-bisphosphatase
29% identity, 91% coverage: 2:183/199 of query aligns to 4:176/191 of 1c7zA
- active site: R8 (= R6), H9 (= H7), N15 (= N13), R58 (= R62), E78 (= E86), H143 (= H150)
- binding glyceraldehyde-3-phosphate: Y89 (≠ R97), R103 (≠ V108), K107 (≠ A112), Y118 (= Y123), Q144 (≠ G151), A145 (≠ V152), R148 (= R155)
1fbtA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 3:175/190 of 1fbtA
- active site: R7 (= R6), H8 (= H7), N14 (= N13), R57 (= R62), E77 (= E86), H142 (= H150)
- binding phosphate ion: R7 (= R6), H8 (= H7), R57 (= R62), E77 (= E86), H142 (= H150), Q143 (≠ G151)
3qpuA Pfkfb3 in complex with ppi (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 241:413/439 of 3qpuA
Sites not aligning to the query:
- binding pyrophosphate 2-: 36, 37, 38, 39, 40, 41, 42, 64, 67, 91, 119, 160, 161, 186, 417
6ic0A Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 4 (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 231:403/428 of 6ic0A
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-pyrimidin-5-yl-pyridine-4-carboxamide: 28, 29, 32, 33, 135, 137, 146, 149, 197, 200, 224, 226, 404
- binding pyrophosphate 2-: 26, 27, 28, 29, 30, 31, 32, 151, 407
2axnA Crystal structure of the human inducible form 6-phosphofructo-2- kinase/fructose-2,6-bisphosphatase (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 244:416/451 of 2axnA
- active site: R248 (= R6), H249 (= H7), N255 (= N13), S298 (≠ R62), E318 (= E86), H383 (= H150)
- binding 6-O-phosphono-beta-D-fructofuranose: I260 (≠ L18), G261 (≠ Q19), E318 (= E86), Y329 (≠ R97), R343 (≠ V108), K347 (≠ A112), Y358 (= Y123), Q384 (≠ G151), R388 (= R155)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 39, 40, 41, 42, 43, 44, 45, 148, 159, 162, 163, 164, 420
- binding {[-(bis-carboxymethyl-amino)-ethyl]-carboxymethyl-amino}-acetic acid: 39, 43, 65, 67, 70, 71, 83, 121, 122, 189
- binding 6-O-phosphono-beta-D-fructofuranose: 436
2i1vB Crystal structure of pfkfb3 in complex with adp and fructose-2,6- bisphosphate (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 244:416/449 of 2i1vB
- binding 6-O-phosphono-beta-D-fructofuranose: I260 (≠ L18), G261 (≠ Q19), E318 (= E86), Y329 (≠ R97), R343 (≠ V108), K347 (≠ A112), Y358 (= Y123), Q384 (≠ G151), R388 (= R155)
- binding phosphonic acid: R248 (= R6), H249 (= H7), N255 (= N13), H383 (= H150)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 39, 40, 41, 42, 43, 44, 45, 159, 163, 164, 213, 420
- binding 2,6-di-O-phosphono-beta-D-fructofuranose: 67, 70, 83, 121, 122, 128, 185, 189
2dwoA Pfkfb3 in complex with adp and pep (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 244:416/449 of 2dwoA
- active site: R248 (= R6), H249 (= H7), N255 (= N13), S298 (≠ R62), E318 (= E86), H383 (= H150)
- binding 6-O-phosphono-beta-D-fructofuranose: I260 (≠ L18), G261 (≠ Q19), E318 (= E86), Y329 (≠ R97), R343 (≠ V108), K347 (≠ A112), Y358 (= Y123), Q384 (≠ G151), R388 (= R155)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 39, 40, 41, 42, 43, 44, 45, 148, 159, 162, 163, 164, 239, 420
- binding 6-O-phosphono-beta-D-fructofuranose: 436
- binding phosphoenolpyruvate: 70, 83, 94, 122, 189
2dwpA A pseudo substrate complex of 6-phosphofructo-2-kinase of pfkfb (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 234:406/431 of 2dwpA
- active site: R238 (= R6), H239 (= H7), N245 (= N13), S288 (≠ R62), E308 (= E86), H373 (= H150)
- binding 6-O-phosphono-beta-D-fructofuranose: I250 (≠ L18), G251 (≠ Q19), E308 (= E86), Y319 (≠ R97), R333 (≠ V108), K337 (≠ A112), Y348 (= Y123), Q374 (≠ G151), R378 (= R155)
Sites not aligning to the query:
- binding phosphomethylphosphonic acid adenylate ester: 29, 30, 31, 32, 33, 34, 35, 138, 149, 152, 153, 154, 203, 410
- binding 6-O-phosphono-beta-D-fructofuranose: 57, 60, 111, 112, 118, 175, 179, 426
6hviA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 2 (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 235:407/433 of 6hviA
- active site: R239 (= R6), H240 (= H7), N246 (= N13), S289 (≠ R62), E309 (= E86), H374 (= H150)
- binding 6-O-phosphono-beta-D-fructofuranose: G252 (≠ Q19), E309 (= E86), Y320 (≠ R97), R334 (≠ V108), K338 (≠ A112), Y349 (= Y123), Q375 (≠ G151), R379 (= R155)
Sites not aligning to the query:
- binding 8-[3-(dimethylamino)phenyl]-~{N}-(4-methylsulfonylpyridin-3-yl)quinoxalin-6-amine: 32, 33, 36, 37, 139, 141, 146, 150, 153, 201, 204, 228, 230
- binding pyrophosphate 2-: 31, 32, 33, 34, 35, 36, 155, 411
6etjA Human pfkfb3 in complex with kan0438241 (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 236:408/432 of 6etjA
- active site: R240 (= R6), H241 (= H7), N247 (= N13), S290 (≠ R62), E310 (= E86), H375 (= H150)
- binding 6-O-phosphono-beta-D-fructofuranose: H241 (= H7), I252 (≠ L18), G253 (≠ Q19), E310 (= E86), Y321 (≠ R97), R335 (≠ V108), K339 (≠ A112), Y350 (= Y123), Q376 (≠ G151), R380 (= R155)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 32, 33, 34, 35, 36, 37, 151, 154, 155, 156, 205, 412
- binding 4-[[3-(5-fluoranyl-2-oxidanyl-phenyl)phenyl]sulfonylamino]-2-oxidanyl-benzoic acid: 58, 59, 62, 75, 83, 86, 113, 114, 115, 120, 181
6ibyA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 6 (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 230:402/428 of 6ibyA
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-[(3~{S})-1-methylpyrrolidin-3-yl]pyridine-4-carboxamide: 27, 31, 32, 134, 136, 145, 148, 196, 199, 200, 223
- binding pyrophosphate 2-: 25, 26, 27, 28, 29, 30, 31, 150, 406
6hvjA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 3 (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 232:404/430 of 6hvjA
- active site: R236 (= R6), H237 (= H7), N243 (= N13), S286 (≠ R62), E306 (= E86), H371 (= H150)
- binding 6-O-phosphono-beta-D-fructofuranose: G249 (≠ Q19), E306 (= E86), Y317 (≠ R97), R331 (≠ V108), K335 (≠ A112), Y346 (= Y123), Q372 (≠ G151), R376 (= R155)
Sites not aligning to the query:
- binding 8-(3-methyl-1-benzofuran-5-yl)-~{N}-(4-methylsulfonylpyridin-3-yl)quinoxalin-6-amine: 29, 33, 34, 136, 138, 143, 147, 151, 198, 225, 407
- binding phosphate ion: 28, 29, 30, 31, 32, 152
5ajyA Human pfkfb3 in complex with an indole inhibitor 4 (see paper)
29% identity, 91% coverage: 2:183/199 of query aligns to 243:415/439 of 5ajyA
- active site: R247 (= R6), H248 (= H7), N254 (= N13), S297 (≠ R62), E317 (= E86), H382 (= H150)
- binding 6-O-phosphono-beta-D-fructofuranose: G260 (≠ Q19), E317 (= E86), Y328 (≠ R97), R342 (≠ V108), K346 (≠ A112), Y357 (= Y123), Q383 (≠ G151), R387 (= R155)
- binding phosphonic acid: R247 (= R6), H248 (= H7), N254 (= N13), H382 (= H150), Q383 (≠ G151)
Sites not aligning to the query:
Query Sequence
>CCNA_01413 FitnessBrowser__Caulo:CCNA_01413
MIYLCRHGQTFHNREGRLQGRTESDLTPLGLLQAQAMGQLLGDLVRREPPAPWRLVASPL
RRARRTAEAIGEHLGLAVDFDERLVEIDVGEWSGRLREEVHGENPHLVGDDAWGFQAPGG
ETYEAMMVRLTSWLSEQATEPERRLIVVSHGVAGRLLRGAYAGLAQEETLRLDIPQDAIY
RLANGQIDRFDCAPIDEPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory