SitesBLAST
Comparing CCNA_01462 FitnessBrowser__Caulo:CCNA_01462 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6dvhA Lactate monooxygenase from mycobacterium smegmatis - c203a mutant (see paper)
58% identity, 99% coverage: 1:387/391 of query aligns to 1:394/394 of 6dvhA
- active site: Y153 (= Y153), D181 (= D181), H291 (= H284)
- binding flavin mononucleotide: V46 (= V46), P98 (= P98), I99 (= I99), G100 (= G100), S129 (= S129), Q151 (= Q151), Y153 (= Y153), T179 (= T179), K267 (= K260), H291 (= H284), G292 (= G285), R294 (= R287), D321 (= D314), S322 (= S315), G323 (= G316), R325 (= R318), R345 (= R338)
P21795 L-lactate 2-monooxygenase; LMO; Lactate monooxygenase; EC 1.13.12.4 from Mycolicibacterium smegmatis (Mycobacterium smegmatis) (see paper)
58% identity, 99% coverage: 1:387/391 of query aligns to 1:394/394 of P21795
6dviD Wild-type lactate monooxygenase from mycobacterium smegmatis (see paper)
54% identity, 99% coverage: 1:387/391 of query aligns to 1:338/338 of 6dviD
- active site: Y153 (= Y153), D181 (= D181), H235 (= H284)
- binding flavin mononucleotide: A97 (≠ S97), P98 (= P98), I99 (= I99), G100 (= G100), S129 (= S129), Q151 (= Q151), Y153 (= Y153), T179 (= T179), K211 (= K260), H235 (= H284), G236 (= G285), R238 (= R287), D265 (= D314), G267 (= G316), R269 (= R318), G288 (= G337), R289 (= R338)
P0DUR7 FMN-dependent alpha-hydroxy acid dehydrogenase qulF; Quinolactacin A2 biosynthesis cluster protein F; EC 1.13.12.- from Penicillium citrinum (see paper)
40% identity, 99% coverage: 3:390/391 of query aligns to 5:396/402 of P0DUR7
- H289 (= H284) mutation to A: Blocks the formatin of 2-aminobenzoylacetamide.
6r9vA Crystal structure of pediococcus acidilactici lactate oxidase a94g mutant (see paper)
37% identity, 93% coverage: 25:387/391 of query aligns to 19:368/369 of 6r9vA
- active site: Y145 (= Y153), D173 (= D181), H264 (= H284)
- binding flavin mononucleotide: I40 (≠ V46), A91 (≠ S97), P92 (= P98), A93 (≠ I99), G94 (= G100), Q143 (= Q151), Y145 (= Y153), T171 (= T179), K240 (= K260), H264 (= H284), R267 (= R287), D295 (= D314), S296 (= S315), R299 (= R318), G318 (= G337), R319 (= R338)
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
37% identity, 91% coverage: 31:384/391 of query aligns to 11:351/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y45), A80 (≠ G100), M81 (≠ V101), W109 (≠ L131), Y131 (= Y153), R166 (= R188), M182 (≠ L205), H250 (= H284), R253 (= R287)
- binding flavin mononucleotide: Y25 (= Y45), Y26 (≠ V46), A78 (≠ P98), T79 (≠ I99), A80 (≠ G100), S107 (= S129), W109 (≠ L131), Q129 (= Q151), Y131 (= Y153), T157 (= T179), K226 (= K260), H250 (= H284), G251 (= G285), R253 (= R287), D281 (= D314), G282 (≠ S315), R285 (= R318), G304 (= G337), R305 (= R338)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
36% identity, 91% coverage: 31:384/391 of query aligns to 12:359/360 of 6gmcA
- active site: Y132 (= Y153), D160 (= D181), H258 (= H284)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y45), M82 (≠ V101), W110 (≠ L131), Y132 (= Y153), R167 (= R188), F191 (≠ G202), L203 (≠ F214), Y206 (≠ I217), H258 (= H284), R261 (= R287)
- binding flavin mononucleotide: Y26 (= Y45), Y27 (≠ V46), A79 (≠ P98), T80 (≠ I99), A81 (≠ G100), S108 (= S129), Q130 (= Q151), Y132 (= Y153), T158 (= T179), K234 (= K260), H258 (= H284), G259 (= G285), R261 (= R287), D289 (= D314), G290 (≠ S315), R293 (= R318), G312 (= G337), R313 (= R338)
7r4oA Structure of human hydroxyacid oxidase 1 bound with 2-((4h-1,2,4- triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one
37% identity, 91% coverage: 31:384/391 of query aligns to 10:340/341 of 7r4oA
- binding flavin mononucleotide: Y25 (≠ V46), A77 (≠ P98), T78 (≠ I99), A79 (≠ G100), S106 (= S129), Q128 (= Q151), Y130 (= Y153), K215 (= K260), H239 (= H284), G240 (= G285), R242 (= R287), D270 (= D314), G271 (≠ S315), R274 (= R318), G293 (= G337), R294 (= R338)
- binding 2-((4H-1,2,4-triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one: Y132 (≠ P155), K133 (= K156), D134 (= D157), N183 (≠ V204), K190 (≠ D211)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
36% identity, 91% coverage: 31:384/391 of query aligns to 9:352/353 of 5qieA
- active site: Y129 (= Y153), D157 (= D181), H251 (= H284)
- binding flavin mononucleotide: Y23 (= Y45), Y24 (≠ V46), A76 (≠ P98), T77 (≠ I99), A78 (≠ G100), S105 (= S129), Q127 (= Q151), Y129 (= Y153), K227 (= K260), H251 (= H284), G252 (= G285), R254 (= R287), D282 (= D314), G283 (≠ S315), R286 (= R318), G305 (= G337), R306 (= R338)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: D322 (≠ H354)
Sites not aligning to the query:
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
37% identity, 91% coverage: 31:384/391 of query aligns to 9:343/344 of 5qihA
- active site: Y129 (= Y153), D157 (= D181), H242 (= H284)
- binding flavin mononucleotide: Y23 (= Y45), Y24 (≠ V46), A76 (≠ P98), T77 (≠ I99), A78 (≠ G100), S105 (= S129), Q127 (= Q151), Y129 (= Y153), K218 (= K260), H242 (= H284), G243 (= G285), R245 (= R287), D273 (= D314), G274 (≠ S315), R277 (= R318), G296 (= G337), R297 (= R338)
- binding 1-methylindazole-3-carboxamide: Y23 (= Y45), A78 (≠ G100), M79 (≠ V101), W107 (≠ L131), Y129 (= Y153), M180 (≠ L205), L187 (≠ F214), H242 (= H284)
5qidA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1787627869
37% identity, 91% coverage: 31:384/391 of query aligns to 9:343/344 of 5qidA
- active site: Y129 (= Y153), D157 (= D181), H242 (= H284)
- binding flavin mononucleotide: Y23 (= Y45), Y24 (≠ V46), A76 (≠ P98), T77 (≠ I99), A78 (≠ G100), S105 (= S129), Q127 (= Q151), Y129 (= Y153), K218 (= K260), H242 (= H284), G243 (= G285), R245 (= R287), D273 (= D314), G274 (≠ S315), R277 (= R318), G296 (= G337), R297 (= R338)
- binding 5-chloranyl-~{N}-methyl-~{N}-[[(3~{S})-oxolan-3-yl]methyl]pyrimidin-4-amine: T57 (≠ R79), E320 (≠ A361), R323 (≠ D364)
5qicA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z30620520
37% identity, 91% coverage: 31:384/391 of query aligns to 9:343/344 of 5qicA
- active site: Y129 (= Y153), D157 (= D181), H242 (= H284)
- binding flavin mononucleotide: Y23 (= Y45), Y24 (≠ V46), A76 (≠ P98), T77 (≠ I99), A78 (≠ G100), S105 (= S129), Q127 (= Q151), Y129 (= Y153), K218 (= K260), H242 (= H284), G243 (= G285), R245 (= R287), D273 (= D314), G274 (≠ S315), R277 (= R318), G296 (= G337), R297 (= R338)
- binding cyclopropyl-[4-(4-fluorophenyl)piperazin-1-yl]methanone: Y131 (≠ P155), K132 (= K156), V136 (≠ L160), M180 (≠ L205), F183 (≠ Y208), Y190 (≠ I217), K193 (= K220), A194 (≠ P221)
5qibA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with fmopl000388a
37% identity, 91% coverage: 31:384/391 of query aligns to 9:343/344 of 5qibA
- active site: Y129 (= Y153), D157 (= D181), H242 (= H284)
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: Y23 (= Y45), Y24 (≠ V46), A76 (≠ P98), T77 (≠ I99), A78 (≠ G100), S105 (= S129), Q127 (= Q151), Y129 (= Y153), K218 (= K260), H242 (= H284), G243 (= G285), R245 (= R287), D273 (= D314), G274 (≠ S315), G275 (= G316), R277 (= R318), G296 (= G337), R297 (= R338)
- binding 5-(cyclohexylamino)pyrimidine-2,4(1H,3H)-dione: Y23 (= Y45), M79 (≠ V101), W107 (≠ L131), Y129 (= Y153), R164 (= R188), M180 (≠ L205), L187 (≠ F214), H242 (= H284), R245 (= R287)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
37% identity, 91% coverage: 31:384/391 of query aligns to 12:361/370 of Q9UJM8
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
37% identity, 91% coverage: 31:384/391 of query aligns to 9:358/359 of 5qigA
- active site: Y129 (= Y153), D157 (= D181), H257 (= H284)
- binding flavin mononucleotide: Y23 (= Y45), Y24 (≠ V46), A76 (≠ P98), T77 (≠ I99), A78 (≠ G100), S105 (= S129), Q127 (= Q151), Y129 (= Y153), T155 (= T179), K233 (= K260), H257 (= H284), G258 (= G285), R260 (= R287), D288 (= D314), G289 (≠ S315), G290 (= G316), R292 (= R318), G311 (= G337), R312 (= R338)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: R223 (= R250), G248 (= G275), F320 (≠ I346), K324 (≠ D350), D328 (≠ H354)
Sites not aligning to the query:
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
37% identity, 91% coverage: 31:384/391 of query aligns to 9:358/359 of 5qifA
- active site: Y129 (= Y153), D157 (= D181), H257 (= H284)
- binding flavin mononucleotide: Y23 (= Y45), Y24 (≠ V46), A76 (≠ P98), T77 (≠ I99), A78 (≠ G100), S105 (= S129), Q127 (= Q151), Y129 (= Y153), K233 (= K260), H257 (= H284), G258 (= G285), R260 (= R287), D288 (= D314), G289 (≠ S315), R292 (= R318), G311 (= G337), R312 (= R338)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (= R250), R224 (≠ S251), S227 (≠ K254)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
37% identity, 91% coverage: 31:384/391 of query aligns to 9:358/359 of 2rdwA
- active site: S105 (= S129), Y129 (= Y153), T155 (= T179), D157 (= D181), K233 (= K260), H257 (= H284)
- binding flavin mononucleotide: Y23 (= Y45), Y24 (≠ V46), A76 (≠ P98), T77 (≠ I99), A78 (≠ G100), Q127 (= Q151), Y129 (= Y153), T155 (= T179), K233 (= K260), H257 (= H284), G258 (= G285), R260 (= R287), D288 (= D314), G289 (≠ S315), R292 (= R318), G311 (= G337), R312 (= R338)
- binding sulfate ion: Y23 (= Y45), W107 (≠ L131), R164 (= R188), H257 (= H284), R260 (= R287)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
37% identity, 91% coverage: 31:384/391 of query aligns to 10:359/360 of 2rduA
- active site: S106 (= S129), Y130 (= Y153), T156 (= T179), D158 (= D181), K234 (= K260), H258 (= H284)
- binding flavin mononucleotide: Y24 (= Y45), Y25 (≠ V46), A77 (≠ P98), T78 (≠ I99), A79 (≠ G100), S106 (= S129), Q128 (= Q151), Y130 (= Y153), T156 (= T179), K234 (= K260), H258 (= H284), G259 (= G285), R261 (= R287), D289 (= D314), G290 (≠ S315), G291 (= G316), R293 (= R318), G312 (= G337), R313 (= R338)
- binding glyoxylic acid: Y24 (= Y45), W108 (≠ L131), Y130 (= Y153), R165 (= R188), H258 (= H284), R261 (= R287)
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
37% identity, 91% coverage: 31:384/391 of query aligns to 12:361/362 of 6gmbA
- active site: Y132 (= Y153), D160 (= D181), H260 (= H284)
- binding flavin mononucleotide: Y26 (= Y45), Y27 (≠ V46), A79 (≠ P98), T80 (≠ I99), A81 (≠ G100), S108 (= S129), Q130 (= Q151), Y132 (= Y153), K236 (= K260), H260 (= H284), G261 (= G285), R263 (= R287), D291 (= D314), G292 (≠ S315), G293 (= G316), R295 (= R318), G314 (= G337), R315 (= R338)
- binding glycolic acid: Y26 (= Y45), W110 (≠ L131), Y132 (= Y153), R167 (= R188), H260 (= H284), R263 (= R287)
2w0uA Crystal structure of human glycolate oxidase in complex with the inhibitor 5-[(4-chlorophenyl)sulfanyl]- 1,2,3-thiadiazole-4- carboxylate. (see paper)
36% identity, 91% coverage: 31:384/391 of query aligns to 8:332/334 of 2w0uA
- active site: S104 (= S129), Y128 (= Y153), T154 (= T179), D156 (= D181), K207 (= K260), H231 (= H284)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y22 (= Y45), M78 (≠ V101), W106 (≠ L131), Y128 (= Y153), R163 (= R188), L176 (≠ F214), Y179 (≠ I217), V180 (≠ L218), H231 (= H284), R234 (= R287)
- binding flavin mononucleotide: Y23 (≠ V46), A75 (≠ P98), T76 (≠ I99), A77 (≠ G100), S104 (= S129), Q126 (= Q151), T154 (= T179), K207 (= K260), H231 (= H284), G232 (= G285), R234 (= R287), D262 (= D314), G263 (≠ S315), R266 (= R318), G285 (= G337), R286 (= R338)
Query Sequence
>CCNA_01462 FitnessBrowser__Caulo:CCNA_01462
MAHYGDYQNEIYGAGLQGVRPKWPVDFKTLEARATAAMSPDLLSYVQGGCGDEFTQRRNA
DAFHDWGVVPRMMVDASKRDLSIELFGLKLPTPLFMSPIGVIGMCAQDGHGDIATAVAAQ
RTGVPVMASTLANDPIEKVGAALGDGVGFFQLYTPKDRDLAESLIRRAETAGFKALVVTL
DTWVTGWRPRDLNDANFPQLRGHVLQNYFTDPRFLEILGKPVAEDPATAIRTWGGLFGKT
LTWEDLAWLRSATKLPIVLKGICHPDDARRAVDLGVDGVFCSNHGGRQANGGIAAIDLLE
DVVTASGNTPVLFDSGVRSGSDAAKALAMGARAVGIGRPYAYGLAIGGVDGVVHVLRSIL
AELDLLMAVDGFPTLAALRDAGVRPVRRAGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory