SitesBLAST
Comparing CCNA_01491 FitnessBrowser__Caulo:CCNA_01491 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
43% identity, 97% coverage: 4:378/386 of query aligns to 7:391/395 of P06721
- K210 (= K200) modified: N6-(pyridoxal phosphate)lysine
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
43% identity, 97% coverage: 4:378/386 of query aligns to 3:387/391 of 2gqnA
- active site: R54 (≠ I49), Y107 (= Y102), D181 (= D175), K206 (= K200)
- binding (5-hydroxy-6-methyl-4-((2-(2-(2-nitrobenzamido)acetyl)hydrazinyl)methyl)pyridin-3-yl)methyl dihydrogen phosphate: C81 (≠ S76), G82 (= G77), A83 (≠ L78), Y107 (= Y102), E108 (≠ K103), D181 (= D175), A203 (= A197), T205 (= T199), K206 (= K200), M215 (≠ F209), Y334 (≠ F328), S335 (= S329), W336 (= W330), R368 (= R359)
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
43% identity, 97% coverage: 4:378/386 of query aligns to 3:387/391 of 2fq6A
- active site: R54 (≠ I49), Y107 (= Y102), D181 (= D175), K206 (= K200)
- binding phosphoric acid mono-(5-hydroxy-6-methyl-4-{[2-(2-trifluoromethyl-benzoylamino)-acetyl]-hydrazonomethyl}-pyridin-3-ylmethyl)ester: C81 (≠ S76), G82 (= G77), A83 (≠ L78), Y107 (= Y102), P109 (= P104), D181 (= D175), A203 (= A197), T205 (= T199), K206 (= K200), M215 (≠ F209), Y334 (≠ F328), S335 (= S329), W336 (= W330), R368 (= R359)
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
43% identity, 97% coverage: 4:378/386 of query aligns to 3:387/391 of 1cl2A
- active site: R54 (≠ I49), Y107 (= Y102), D181 (= D175), K206 (= K200)
- binding (2E,3E)-4-(2-aminoethoxy)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: C81 (≠ S76), G82 (= G77), A83 (≠ L78), Y107 (= Y102), D181 (= D175), A203 (= A197), T205 (= T199), K206 (= K200), M215 (≠ F209), Y334 (≠ F328), S335 (= S329), W336 (= W330), R368 (= R359)
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
43% identity, 97% coverage: 4:378/386 of query aligns to 4:388/392 of 1cl1B
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
42% identity, 97% coverage: 4:378/386 of query aligns to 3:387/391 of 4itxA
- active site: R54 (≠ I49), Y107 (= Y102), D181 (= D175), K206 (= K200)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: C81 (≠ S76), G82 (= G77), A83 (≠ L78), Y107 (= Y102), D181 (= D175), A203 (= A197), T205 (= T199), K206 (= K200), M215 (≠ F209), Y334 (≠ F328), S335 (= S329), W336 (= W330), R368 (= R359)
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
42% identity, 97% coverage: 4:378/386 of query aligns to 10:394/398 of 8sadA
- binding magnesium ion: A359 (= A346), R362 (≠ I349), A365 (vs. gap)
- binding pyridoxal-5'-phosphate: C88 (≠ S76), G89 (= G77), A90 (≠ L78), Y114 (= Y102), D188 (= D175), A210 (= A197), T212 (= T199), K213 (= K200), M222 (≠ F209), W343 (= W330)
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
42% identity, 97% coverage: 4:378/386 of query aligns to 3:387/391 of 8u99A
- binding pyridoxal-5'-phosphate: C81 (≠ S76), G82 (= G77), A83 (≠ L78), Y107 (= Y102), D181 (= D175), T205 (= T199), K206 (= K200), M215 (≠ F209), W336 (= W330)
- binding serine: Y107 (= Y102), K206 (= K200), Y334 (≠ F328), S335 (= S329), W336 (= W330), R368 (= R359)
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
42% identity, 97% coverage: 4:378/386 of query aligns to 3:387/391 of 8u98A
- binding glycine: Y107 (= Y102), K206 (= K200), Y334 (≠ F328), S335 (= S329), W336 (= W330), R368 (= R359)
- binding pyridoxal-5'-phosphate: Y52 (= Y47), R54 (≠ I49), C81 (≠ S76), G82 (= G77), A83 (≠ L78), Y107 (= Y102), D181 (= D175), A203 (= A197), T205 (= T199), K206 (= K200), M215 (≠ F209), W336 (= W330)
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
42% identity, 97% coverage: 4:378/386 of query aligns to 3:387/391 of 8sa9A
- binding pyridoxal-5'-phosphate: C81 (≠ S76), G82 (= G77), A83 (≠ L78), Y107 (= Y102), D181 (= D175), A203 (= A197), T205 (= T199), K206 (= K200), M215 (≠ F209), W336 (= W330)
- binding [({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino](oxo)acetic acid: C81 (≠ S76), G82 (= G77), A83 (≠ L78), Y107 (= Y102), D181 (= D175), A203 (= A197), T205 (= T199), K206 (= K200), M215 (≠ F209), S335 (= S329), W336 (= W330), R368 (= R359)
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
42% identity, 97% coverage: 4:378/386 of query aligns to 4:388/392 of 8sabA
- binding lysine: N9 (≠ H9), R12 (≠ S12), R13 (≠ E13), K14 (≠ P14), T17 (≠ L17), L330 (= L323), E341 (= E334)
- binding pyridoxal-5'-phosphate: C82 (≠ S76), G83 (= G77), A84 (≠ L78), Y108 (= Y102), D182 (= D175), A204 (= A197), T206 (= T199), K207 (= K200), M216 (≠ F209), W337 (= W330)
- binding alanyl-pyridoxal-5'-phosphate: C82 (≠ S76), G83 (= G77), A84 (≠ L78), Y108 (= Y102), D182 (= D175), A204 (= A197), T206 (= T199), K207 (= K200), M216 (≠ F209), Y335 (≠ F328), S336 (= S329), W337 (= W330), R369 (= R359)
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
34% identity, 97% coverage: 5:380/386 of query aligns to 11:387/390 of 8j6nA
- binding [6-methyl-4-[(~{E})-(oxamoylhydrazinylidene)methyl]-5-oxidanyl-pyridin-3-yl]methyl dihydrogen phosphate: Y51 (= Y47), R53 (≠ I49), G81 (= G77), L82 (= L78), Y105 (= Y102), E148 (= E146), N152 (≠ S150), D178 (= D175), S200 (≠ A197), T202 (= T199), K203 (= K200), E330 (≠ F328), S331 (= S329), T346 (≠ G345), R366 (= R359)
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
33% identity, 98% coverage: 1:378/386 of query aligns to 1:370/373 of 4l0oH
- active site: R40 (≠ I49), Y92 (= Y102), D164 (= D175), K189 (= K200)
- binding pyridoxal-5'-phosphate: Y38 (= Y47), R40 (≠ I49), S67 (= S76), G68 (= G77), L69 (= L78), Y92 (= Y102), D164 (= D175), S186 (≠ A197), T188 (= T199), K189 (= K200)
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
33% identity, 98% coverage: 5:382/386 of query aligns to 9:375/377 of 7ba4A
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
33% identity, 98% coverage: 5:382/386 of query aligns to 6:384/384 of 4iyoD
- active site: R47 (≠ I49), Y99 (= Y102), D172 (= D175), K197 (= K200)
- binding serine: Y45 (= Y47), T48 (= T50), Y99 (= Y102), Y99 (= Y102), R104 (= R107), K197 (= K200), N227 (≠ W229), E325 (≠ F328), S326 (= S329), T341 (≠ G345), R361 (= R359)
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
33% identity, 97% coverage: 5:378/386 of query aligns to 6:380/381 of 4iyoB
- active site: R47 (≠ I49), Y99 (= Y102), D172 (= D175), K197 (= K200)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y47), R47 (≠ I49)
- binding amino-acrylate: Y99 (= Y102), K197 (= K200), S326 (= S329), T341 (≠ G345), R361 (= R359)
- binding pyruvic acid: Q221 (≠ L223), F224 (≠ D226)
- binding serine: Y45 (= Y47), T48 (= T50), Y99 (= Y102), R104 (= R107), N227 (≠ W229), E325 (≠ F328)
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
33% identity, 97% coverage: 5:378/386 of query aligns to 6:380/381 of 4iy7B
- active site: R47 (≠ I49), Y99 (= Y102), D172 (= D175), K197 (= K200)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y47), R47 (≠ I49)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: G75 (= G77), M76 (≠ L78), Y99 (= Y102), E143 (= E146), N147 (≠ S150), D172 (= D175), S194 (≠ A197), K197 (= K200), S326 (= S329), L327 (≠ W330), T341 (≠ G345), R361 (= R359)
- binding pyruvic acid: Q221 (≠ L223), F224 (≠ D226)
- binding serine: Y45 (= Y47), T48 (= T50), Y99 (= Y102), R104 (= R107), N227 (≠ W229), E325 (≠ F328)
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
33% identity, 97% coverage: 5:378/386 of query aligns to 6:380/381 of 4iy7A
- active site: R47 (≠ I49), Y99 (= Y102), D172 (= D175), K197 (= K200)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: G75 (= G77), M76 (≠ L78), Y99 (= Y102), E143 (= E146), N147 (≠ S150), D172 (= D175), S194 (≠ A197), K197 (= K200), S326 (= S329), L327 (≠ W330), T341 (≠ G345), R361 (= R359)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: Y45 (= Y47), R47 (≠ I49)
- binding serine: Y45 (= Y47), T48 (= T50), Y99 (= Y102), R104 (= R107), N227 (≠ W229), E325 (≠ F328)
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
33% identity, 97% coverage: 5:378/386 of query aligns to 6:380/381 of 4ixzA
5eigC Engineered human cystathionine gamma lyase (e59t, e339v) to deplet cysteine
35% identity, 86% coverage: 5:337/386 of query aligns to 11:337/388 of 5eigC
Query Sequence
>CCNA_01491 FitnessBrowser__Caulo:CCNA_01491
MDEETRLIHTGSEPARLGRTVNPPIQRGSTVLLPDAASLYDDDQLTYGITGLSTPVALQN
ALAELEGATNVTLYPSGLAAITGAMLAVLKAGDEVLVVDSAYKPTRRFCDRVLGRFGVTT
RYYDPKLSPEALMGLVTSSTRLIVLEAPGSLTFEMQDIPAIAAAANARGVLTLIDNTWAA
GLLFKPLAHGVTMSVQALTKYVGGHSDCFMGSVATCDDAVAKLLGDAMWDIGWSVSSDDA
YTMLRGLRTLATRLPRHAENGLAIARWLQERPEVARVLHPALPGDAGHAIWKRDFTGACG
LFGVVLKPCSQKAVHAFLDSLKLFGLGFSWGGYESLALNCDPQLGARSIPVDLEGPLLRF
HIGLEGIEDLKADLRRGFEALNAAKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory