Comparing CCNA_01496 FitnessBrowser__Caulo:CCNA_01496 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3e0iA Cu2+ substituted aquifex aeolicus kdo8ps in complex with pep (see paper)
51% identity, 87% coverage: 29:278/287 of query aligns to 1:250/263 of 3e0iA
2a21A Aquifex aeolicus kdo8ps in complex with pep, po4, and zn2+ (see paper)
51% identity, 87% coverage: 29:278/287 of query aligns to 1:250/263 of 2a21A
1jcyA Aquifex aeolicus kdo8p synthase in complex with r5p, pep and cadmium (see paper)
51% identity, 87% coverage: 29:278/287 of query aligns to 1:250/263 of 1jcyA
1fwwA Aquifex aeolicus kdo8p synthase in complex with pep, a5p and cadmium (see paper)
51% identity, 87% coverage: 29:278/287 of query aligns to 1:250/263 of 1fwwA
1fwtA Aquifex aeolicus kdo8p synthase in complex with pep, e4p and cadmium (see paper)
51% identity, 87% coverage: 29:278/287 of query aligns to 1:250/263 of 1fwtA
2nx3D Structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase (see paper)
50% identity, 87% coverage: 30:278/287 of query aligns to 1:249/262 of 2nx3D
2nx1A Structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase (see paper)
50% identity, 87% coverage: 29:278/287 of query aligns to 1:250/263 of 2nx1A
3e12A Cu2+ substituted aquifex aeolicus kdo8ps in complex with kdo8p (see paper)
50% identity, 87% coverage: 29:278/287 of query aligns to 1:245/258 of 3e12A
1pe1A Aquifex aeolicus kdo8ps in complex with cadmium and 2-pga (see paper)
49% identity, 87% coverage: 29:278/287 of query aligns to 2:245/258 of 1pe1A
1pcwA Aquifex aeolicus kdo8ps in complex with cadmium and app, a bisubstrate inhibitor (see paper)
49% identity, 87% coverage: 29:278/287 of query aligns to 1:244/257 of 1pcwA
1pckA Aquifex aeolicus kdo8ps in complex with z-methyl-pep (see paper)
49% identity, 87% coverage: 29:278/287 of query aligns to 1:245/258 of 1pckA
1jcxA Aquifex aeolicus kdo8p synthase in complex with api and cadmium (see paper)
49% identity, 87% coverage: 29:278/287 of query aligns to 1:242/255 of 1jcxA
3undB Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei (see paper)
45% identity, 92% coverage: 23:285/287 of query aligns to 12:276/284 of 3undB
1g7vA Crystal structures of kdo8p synthase in its binary complexes with the mechanism-based inhibitor (see paper)
43% identity, 92% coverage: 23:286/287 of query aligns to 11:276/284 of 1g7vA
1g7uA Crystal structures of kdo8p synthase in its binary complex with substrate phosphoenol pyruvate (see paper)
43% identity, 92% coverage: 23:285/287 of query aligns to 11:275/284 of 1g7uA
1x6uA Kdo8p synthase in it's binary complex with the product kdo8p (see paper)
42% identity, 92% coverage: 23:285/287 of query aligns to 11:263/272 of 1x6uA
1phwA Crystal structure of kdo8p synthase in its binary complex with substrate analog 1-deoxy-a5p (see paper)
42% identity, 92% coverage: 23:285/287 of query aligns to 11:263/272 of 1phwA
1phqA Crystal structure of kdo8p synthase in its binary complex with substrate analog e-fpep
42% identity, 92% coverage: 23:285/287 of query aligns to 11:263/272 of 1phqA
1gg0A Crystal structure analysis of kdop synthase at 3.0 a (see paper)
42% identity, 92% coverage: 23:285/287 of query aligns to 11:266/275 of 1gg0A
4z1dA Structure of pep and zinc bound kdo8ps from h.Pylori (see paper)
45% identity, 87% coverage: 33:283/287 of query aligns to 4:255/256 of 4z1dA
>CCNA_01496 FitnessBrowser__Caulo:CCNA_01496
MDQPKAVAPNAVVEIKTPTGAPVRIGNGEKLSIIAGPCQMESRQHALETAHALKEMADRL
GVGLIYKTSYDKANRTSANAQRGIGLKDSLAIFQEIREVTGLPTLTDVHETSHCSIVAEA
VDVIQIPAFLCRQTDLLVAAASTGRAINIKKGQFLAPWDMKNVIAKVTGAGNPNVMACER
GASFGYNTLVSDMRALPIMKEIGCPVVFDATHSVQQPGGQGTSSGGQREFVPTLARAAVA
VGVACVFIETHPDPDNAPSDGPNMVPVKEFEALVANLLRYDALTKAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory