Comparing CCNA_01506 FitnessBrowser__Caulo:CCNA_01506 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
54% identity, 98% coverage: 1:240/246 of query aligns to 1:240/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
54% identity, 98% coverage: 1:240/246 of query aligns to 1:240/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
54% identity, 98% coverage: 1:240/246 of query aligns to 1:240/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
54% identity, 98% coverage: 1:240/246 of query aligns to 1:240/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
56% identity, 96% coverage: 4:240/246 of query aligns to 3:238/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
55% identity, 96% coverage: 4:240/246 of query aligns to 2:238/240 of 4ymuJ
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
48% identity, 95% coverage: 9:241/246 of query aligns to 12:256/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
48% identity, 95% coverage: 9:241/246 of query aligns to 8:252/258 of 1b0uA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
42% identity, 87% coverage: 4:216/246 of query aligns to 4:220/226 of 5xu1B
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 89% coverage: 19:238/246 of query aligns to 21:241/343 of P30750
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
41% identity, 89% coverage: 4:222/246 of query aligns to 5:227/648 of P75831
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 89% coverage: 19:238/246 of query aligns to 22:242/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 89% coverage: 19:238/246 of query aligns to 22:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 89% coverage: 19:238/246 of query aligns to 22:242/344 of 3tuiC
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
42% identity, 83% coverage: 18:222/246 of query aligns to 23:227/650 of 5ws4A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 89% coverage: 19:237/246 of query aligns to 21:232/232 of 1f3oA
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
40% identity, 80% coverage: 19:216/246 of query aligns to 21:223/230 of 1l2tA
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
39% identity, 83% coverage: 16:218/246 of query aligns to 22:226/233 of P75957
7mdyC Lolcde nucleotide-bound
39% identity, 83% coverage: 16:218/246 of query aligns to 19:223/226 of 7mdyC
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 93% coverage: 9:238/246 of query aligns to 33:263/382 of 7ahhC
Sites not aligning to the query:
>CCNA_01506 FitnessBrowser__Caulo:CCNA_01506
MSAIDAKSLKKSFGDTPVLAGVDLAVVPGEVVAIIGPSGSGKSTLLRCLAGLEPLNDGDL
TIAGVAAGGKTPLAKALNGRVGFVFQSFNLFPHRTALENVIEGPIVVRREDPAKARAKGL
ALLEKVGLADRVDAYPSALSGGQQQRCAIARALAMDPEVILFDEPTSALDPELVGEVLAV
IRDLAAEKRTMVIVTHQMDFARDVAERTIFMDGGVIVEQGPSRQLLASPREERTRRFLAR
SGVLQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory