SitesBLAST
Comparing CCNA_01559 FitnessBrowser__Caulo:CCNA_01559 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
67% identity, 99% coverage: 3:255/255 of query aligns to 2:246/246 of 4hp8B
- active site: G19 (= G20), S138 (= S147), V148 (= V157), Y151 (= Y160), K155 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), N17 (= N18), T18 (= T19), G19 (= G20), L20 (≠ I21), R40 (= R41), R41 (≠ S42), D63 (= D64), F64 (= F65), N85 (= N91), G87 (= G93), I88 (= I94), I136 (= I145), Y151 (= Y160), K155 (= K164), P181 (= P190), G182 (= G191), I184 (≠ F193), T186 (= T195), N188 (= N197), T189 (= T198)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
62% identity, 99% coverage: 3:255/255 of query aligns to 4:247/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), D19 (≠ N18), L22 (≠ I21), I42 (≠ R41), D65 (= D64), M66 (≠ F65), N92 (= N91), A93 (= A92), G94 (= G93), L115 (≠ T114), I143 (= I145), S145 (= S147), Y158 (= Y160), K162 (= K164), G189 (= G191), M191 (≠ F193), T193 (= T195), N195 (= N197)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
49% identity, 98% coverage: 4:254/255 of query aligns to 2:248/249 of 3uf0A
- active site: G18 (= G20), S141 (= S147), V151 (= V157), Y154 (= Y160), K158 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S17 (≠ T19), G18 (= G20), I19 (= I21), R39 (= R41), D63 (= D64), L64 (≠ F65), N89 (= N91), G91 (= G93), I92 (= I94), I139 (= I145), A140 (= A146), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (= G191), V187 (≠ F193), T189 (= T195), N191 (= N197), T192 (= T198)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
43% identity, 98% coverage: 5:253/255 of query aligns to 1:246/247 of 4jroC
- active site: G16 (= G20), S142 (= S147), Q152 (≠ V157), Y155 (= Y160), K159 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ N18), R15 (≠ T19), G16 (= G20), I17 (= I21), N35 (≠ A39), Y36 (≠ G40), N37 (≠ R41), G38 (≠ S42), S39 (≠ A43), N63 (≠ D64), V64 (≠ F65), N90 (= N91), A91 (= A92), I93 (= I94), I113 (≠ T114), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), I188 (≠ F193), T190 (= T195)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
41% identity, 98% coverage: 5:254/255 of query aligns to 2:251/252 of 1vl8B
- active site: G17 (= G20), S143 (= S147), I154 (≠ V157), Y157 (= Y160), K161 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), R16 (≠ T19), G17 (= G20), L18 (≠ I21), S37 (≠ G40), R38 (= R41), C63 (≠ A63), D64 (= D64), V65 (≠ F65), A91 (≠ N91), A92 (= A92), G93 (= G93), I94 (= I94), V114 (≠ T114), I141 (= I145), S143 (= S147), Y157 (= Y160), K161 (= K164), P187 (= P190), G188 (= G191), Y190 (≠ F193), T192 (= T195), M194 (≠ N197), T195 (= T198)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
39% identity, 97% coverage: 5:252/255 of query aligns to 4:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ N18), R18 (≠ T19), I20 (= I21), T40 (≠ R41), N62 (≠ D64), V63 (≠ F65), N89 (= N91), A90 (= A92), I92 (= I94), V139 (≠ I145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (= G191), I187 (≠ F193), T189 (= T195), M191 (≠ N197)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
42% identity, 98% coverage: 3:251/255 of query aligns to 10:256/261 of 5u9pB
- active site: G27 (= G20), S152 (= S147), Y165 (= Y160), K169 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G16), R26 (≠ T19), G27 (= G20), I28 (= I21), R48 (= R41), D73 (≠ S66), V74 (≠ S67), N100 (= N91), A101 (= A92), I150 (= I145), Y165 (= Y160), K169 (= K164), P195 (= P190), F198 (= F193), T200 (= T195), L202 (≠ N197), N203 (≠ T198)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
42% identity, 98% coverage: 5:254/255 of query aligns to 7:248/254 of 3o03A
- active site: G22 (= G20), S147 (= S147), V157 (= V157), Y160 (= Y160), K164 (= K164)
- binding calcium ion: S147 (= S147), M148 (≠ L148), P190 (= P190)
- binding D-gluconic acid: I99 (= I95), R101 (= R97), S147 (= S147), M149 (≠ L149), R154 (≠ G154), Y160 (= Y160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G16), Y21 (≠ T19), G22 (= G20), I23 (= I21), D42 (≠ A38), I43 (≠ A39), L47 (≠ A43), D68 (= D64), V69 (≠ F65), N95 (= N91), A96 (= A92), G97 (= G93), I145 (= I145), Y160 (= Y160), K164 (= K164), P190 (= P190)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 97% coverage: 5:252/255 of query aligns to 1:241/244 of P0AEK2
- GASR 12:15 (≠ GANT 16:19) binding
- T37 (≠ R41) binding
- NV 59:60 (≠ DF 64:65) binding
- N86 (= N91) binding
- Y151 (= Y160) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YTASK 160:164) binding
- A154 (≠ S163) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K164) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ F193) binding
- E233 (≠ I244) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
39% identity, 97% coverage: 5:252/255 of query aligns to 1:241/244 of 6t77A
- active site: G16 (= G20), S138 (= S147), Y151 (= Y160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ N18), R15 (≠ T19), T37 (≠ R41), L58 (≠ A63), N59 (≠ D64), V60 (≠ F65), A87 (= A92), G88 (= G93), I89 (= I94)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
39% identity, 97% coverage: 6:252/255 of query aligns to 1:240/243 of 1q7bA
- active site: G15 (= G20), E101 (≠ D107), S137 (= S147), Q147 (≠ V157), Y150 (= Y160), K154 (= K164)
- binding calcium ion: E232 (≠ I244), T233 (= T245)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ N18), R14 (≠ T19), T36 (≠ R41), N58 (≠ D64), V59 (≠ F65), N85 (= N91), A86 (= A92), G87 (= G93), I88 (= I94), S137 (= S147), Y150 (= Y160), K154 (= K164), P180 (= P190), G181 (= G191), I183 (≠ F193)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
39% identity, 97% coverage: 6:252/255 of query aligns to 1:240/243 of 1q7cA
- active site: G15 (= G20), S137 (= S147), Q147 (≠ V157), F150 (≠ Y160), K154 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ N18), R14 (≠ T19), A35 (≠ G40), T36 (≠ R41), L57 (≠ A63), N58 (≠ D64), V59 (≠ F65), G87 (= G93), I88 (= I94)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 97% coverage: 5:252/255 of query aligns to 1:241/244 of P0A2C9
- M125 (≠ A130) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A234) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S235) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
38% identity, 97% coverage: 5:252/255 of query aligns to 4:240/243 of 4i08A
- active site: G19 (= G20), N113 (= N115), S141 (= S147), Q151 (≠ V157), Y154 (= Y160), K158 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ N18), R18 (≠ T19), I20 (= I21), T40 (≠ R41), N62 (≠ D64), V63 (≠ F65), N89 (= N91), A90 (= A92), G140 (≠ A146), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (= G191), T189 (= T195)
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
42% identity, 98% coverage: 7:255/255 of query aligns to 2:236/236 of 1x1tA
- active site: G15 (= G20), N114 (= N115), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding cacodylate ion: S142 (= S147), H144 (≠ L149), Y155 (= Y160), W187 (≠ Y192), W233 (= W252)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (≠ N18), S14 (≠ T19), G15 (= G20), I16 (= I21), G35 (= G40), F36 (≠ R41), D63 (= D64), L64 (≠ F65), N90 (= N91), G92 (= G93), L113 (≠ T114), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), W187 (≠ Y192), V188 (≠ F193), T190 (= T195)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
42% identity, 98% coverage: 7:255/255 of query aligns to 2:260/260 of 2ztlA
- active site: G15 (= G20), N114 (= N115), S142 (= S147), Y155 (= Y160), K159 (= K164), L200 (= L201)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ I95), S142 (= S147), H144 (≠ L149), K152 (≠ V157), Y155 (= Y160), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), G15 (= G20), I16 (= I21), F36 (≠ R41), L64 (≠ F65), N90 (= N91), A91 (= A92), G92 (= G93), L113 (≠ T114), Y155 (= Y160), K159 (= K164), P185 (= P190), W187 (≠ Y192), V188 (≠ F193), T190 (= T195), V193 (≠ T198)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
42% identity, 98% coverage: 7:255/255 of query aligns to 2:260/260 of 1wmbA
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
40% identity, 99% coverage: 2:253/255 of query aligns to 1:246/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G16), R18 (≠ T19), G19 (= G20), I20 (= I21), D39 (≠ G40), R40 (= R41), C63 (≠ A63), I65 (≠ F65), N91 (= N91), G93 (= G93), I94 (= I94), V114 (≠ T114), Y155 (= Y160), K159 (= K164), I188 (≠ F193), T190 (= T195), T193 (= T198)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 95% coverage: 10:252/255 of query aligns to 5:244/246 of 3osuA
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
39% identity, 97% coverage: 6:252/255 of query aligns to 1:240/243 of 7emgB
Query Sequence
>CCNA_01559 FitnessBrowser__Caulo:CCNA_01559
MANPFSLEGKVALITGANTGIGQGIAIALAAAGADIAAAGRSAPTETQAAVEALGRKFLS
IKADFSSIEPVQRVVDETVAAFGKVDILVNNAGIIRRADSIEFSEADWDAVMDTNLKVVF
FLTQAFAKQALKQGFEGGQAKVINIASLLSFQGGIRVPSYTASKSGLAGLTKILANEWAT
KGINVNAIAPGYFDTNNTEALRADQDRNAAILARIPAGRWGRPEDIGGAAVFLASSASDY
VQGITLPVDGGWLAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory