Comparing CCNA_01563 FitnessBrowser__Caulo:CCNA_01563 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2afbA Crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution (see paper)
39% identity, 93% coverage: 18:361/368 of query aligns to 8:329/329 of 2afbA
Sites not aligning to the query:
3ktnA Crystal structure of a putative 2-keto-3-deoxygluconate kinase from enterococcus faecalis
27% identity, 95% coverage: 19:368/368 of query aligns to 5:337/340 of 3ktnA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
27% identity, 89% coverage: 33:360/368 of query aligns to 20:302/309 of Q53W83
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
30% identity, 54% coverage: 33:231/368 of query aligns to 20:202/300 of 1v1bA
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
30% identity, 54% coverage: 33:231/368 of query aligns to 20:202/301 of 1v1aA
Sites not aligning to the query:
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
22% identity, 93% coverage: 20:360/368 of query aligns to 5:306/308 of 2dcnA
8cqxA Ribokinase from t.Sp mutant a92g
43% identity, 16% coverage: 303:361/368 of query aligns to 241:300/300 of 8cqxA
Sites not aligning to the query:
6znxC Ribokinase from thermus species
43% identity, 16% coverage: 303:361/368 of query aligns to 206:265/265 of 6znxC
Sites not aligning to the query:
>CCNA_01563 FitnessBrowser__Caulo:CCNA_01563
MTDNILNIRPPSETKWDCASFGEVMLRFDPGFGRVRNARQFQVWEGGGEYNVARAFKKCW
GKRSTAVTALPVNDLGWLVEDLMMQGGVDTSHIIWRDFDGLGRNTRVGLNFTEKGFGVRP
ALGCSDRGHSAASQIRPGEVNWEKLFGEEGVRWFHTGGIFAALASNTAEAVIEAVEVARK
YGTVVSYDLNYRASLWKSQGGKEGAQKVNRHIAQYVDVMIGNEEDFTACLGFEVEGLDEH
ISSIDPANFKKMIETAVKQFPNFKVAATTLRNAKTASVNDWSAILYAGGQFYASMMRENL
EIYDRVGGGDGFASGLAYGFMEGKGPQAAVEYGAAHGALAMTTPGDTSMVRKEEVEAVMK
GKGARVIR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory