Comparing CCNA_01575 FitnessBrowser__Caulo:CCNA_01575 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
7cdyA Crystal structure of glucose dehydrogenase
51% identity, 83% coverage: 67:404/408 of query aligns to 6:343/346 of 7cdyA
7cgzA Glucose dehydrogenase
48% identity, 83% coverage: 67:404/408 of query aligns to 6:318/321 of 7cgzA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
44% identity, 84% coverage: 65:407/408 of query aligns to 28:370/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
44% identity, 84% coverage: 65:407/408 of query aligns to 6:348/348 of 2g8sA
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
36% identity, 83% coverage: 63:400/408 of query aligns to 5:320/338 of 3a9hA
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
36% identity, 83% coverage: 63:400/408 of query aligns to 5:320/338 of 3a9gA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
34% identity, 82% coverage: 65:400/408 of query aligns to 5:319/333 of 2ismB
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
32% identity, 82% coverage: 65:400/408 of query aligns to 12:318/334 of 3dasA
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
28% identity, 84% coverage: 65:405/408 of query aligns to 20:444/444 of 1cq1A
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
28% identity, 84% coverage: 65:405/408 of query aligns to 20:444/444 of 1c9uA
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
28% identity, 84% coverage: 65:407/408 of query aligns to 20:452/453 of 5minB
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
27% identity, 84% coverage: 65:408/408 of query aligns to 44:477/478 of P13650
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
28% identity, 84% coverage: 65:405/408 of query aligns to 20:448/448 of 1cruA
2wfxB Crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog in the presence of calcium (see paper)
25% identity, 46% coverage: 65:251/408 of query aligns to 6:203/417 of 2wfxB
Sites not aligning to the query:
7pgnB Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
25% identity, 46% coverage: 65:251/408 of query aligns to 7:208/438 of 7pgnB
Sites not aligning to the query:
7pgnA Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
24% identity, 50% coverage: 65:269/408 of query aligns to 8:227/437 of 7pgnA
Sites not aligning to the query:
7pgmB Hhip-c in complex with heparin (see paper)
25% identity, 46% coverage: 65:251/408 of query aligns to 7:203/427 of 7pgmB
Sites not aligning to the query:
>CCNA_01575 FitnessBrowser__Caulo:CCNA_01575
MRTTLLTASAALAAALAACGPAPAQPGQAGAPVESRAPNSPDQKPAFAGQTRAPGLVSGV
SGQYQTLASGLEHPWGMAFLPSGEILVTERAGRLRVVGKDGKLSPAVTGLPAIYAEGQGG
LLGVTLDPDYAKNGLVYWAYAEEIDSVNGTAVARGKLTLGAAPKVENVQVIWRQTPKMAS
PLHFGGRVVFDRAGKLFITTGERAYPAGRVQSQNLDGTLGKVVRINADGSIPSDNPFVNT
AGAKPDIWSLGHRNIQSATLDAQGRLWTVEHGARGGDELNRPEPGKNYGWPLITYGEEYS
GKAISDGATQKEGLEQPVYYWDPVIAPSGMALYDGALFPALKGSLLIGSMREQHVARLVL
KDDKVVGEERLFTDIGGRVRDVAVGPDGAIYVLTDEGDGKLIKITPKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory