Comparing CCNA_01577 FitnessBrowser__Caulo:CCNA_01577 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
2eb5A Crystal structure of hpcg complexed with oxalate (see paper)
27% identity, 94% coverage: 12:267/272 of query aligns to 6:256/259 of 2eb5A
2eb6A Crystal structure of hpcg complexed with mg ion (see paper)
27% identity, 95% coverage: 12:270/272 of query aligns to 6:267/267 of 2eb6A
P42270 2-oxo-hept-4-ene-1,7-dioate hydratase; OHED hydratase; EC 4.2.1.163 from Escherichia coli (see paper)
27% identity, 95% coverage: 12:270/272 of query aligns to 6:267/267 of P42270
>CCNA_01577 FitnessBrowser__Caulo:CCNA_01577
MTVSKADSEIFTPTAIAPQFVQARQQGVSVPGYPGGVIPSSMADGYAVQDIAIDLWPDEL
VGWKVGLVPPQHRERLGAERLAGCIFKSKVQQASADAPNTFRAIEGGFCAVEAEFIIRLG
KDAPANKTDWTVEEAADYVGELLVGVEIAGSPLKTINALGPTVVASDFGNNDGQIIGQAI
SNWRDLAWEDMPVETFINGKSVGTATAAAIPGSPIAALAFLLGAVAARGKPLKKGQIVTT
GATTGIHDVVAGDVAHISFGPFGTVDCVAVPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory