SitesBLAST
Comparing CCNA_01645 FitnessBrowser__Caulo:CCNA_01645 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
38% identity, 92% coverage: 1:262/286 of query aligns to 14:277/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (≠ M8), G22 (= G9), I23 (≠ V10), M24 (= M11), N43 (= N30), R44 (= R31), T45 (≠ S32), K48 (= K35), V77 (= V65), S78 (≠ G66), D82 (= D70), Q85 (≠ D73), V133 (= V118), F244 (= F229), K245 (≠ A230), H248 (≠ W233), K251 (= K236)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
38% identity, 92% coverage: 1:262/286 of query aligns to 14:274/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (≠ M8), G22 (= G9), I23 (≠ V10), M24 (= M11), N43 (= N30), R44 (= R31), T45 (≠ S32), K48 (= K35), M76 (≠ C64), V77 (= V65), S78 (≠ G66), D82 (= D70), Q85 (≠ D73), V133 (= V118), F241 (= F229), K242 (≠ A230), H245 (≠ W233), K248 (= K236)
- binding sulfate ion: T134 (≠ S119), G135 (= G120), K183 (= K168)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
36% identity, 91% coverage: 2:262/286 of query aligns to 2:259/288 of 1wp4A
- active site: S116 (= S119), K164 (= K168), N167 (= N171), N168 (≠ Q172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), L8 (≠ M8), G9 (= G9), A10 (≠ V10), M11 (= M11), N29 (= N30), R30 (= R31), T31 (≠ S32), K34 (= K35), C61 (= C64), L62 (≠ V65), P63 (≠ G66), E67 (≠ D70), S90 (≠ T93), V115 (= V118), T225 (≠ G228), F226 (= F229), K233 (= K236)
- binding sulfate ion: S116 (= S119), G117 (= G120), G118 (= G121), K164 (= K168)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
36% identity, 91% coverage: 2:262/286 of query aligns to 3:260/289 of 2cvzC
- active site: S117 (= S119), K165 (= K168), N168 (= N171), N169 (≠ Q172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), L9 (≠ M8), G10 (= G9), A11 (≠ V10), M12 (= M11), N30 (= N30), R31 (= R31), T32 (≠ S32), C62 (= C64), L63 (≠ V65), P64 (≠ G66), E68 (≠ D70), E71 (≠ D73), S91 (≠ T93), V116 (= V118), F227 (= F229), K234 (= K236)
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
35% identity, 92% coverage: 4:267/286 of query aligns to 5:274/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (≠ Q129), E149 (= E149), A152 (= A152), G153 (≠ K153), G153 (≠ K153), K154 (≠ A154)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (= S119), G120 (= G120), W211 (= W211), F236 (= F229)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G10 (= G9), N11 (≠ V10), M12 (= M11), F30 (≠ Y29), D31 (≠ N30), P32 (≠ R31), M64 (≠ C64), L65 (≠ V65), T93 (= T93), G121 (= G121), K168 (= K168), L240 (≠ W233), K243 (= K236)
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
35% identity, 92% coverage: 4:267/286 of query aligns to 5:274/290 of 5y8kA
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
35% identity, 92% coverage: 4:267/286 of query aligns to 4:273/292 of 5y8iA
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
35% identity, 92% coverage: 4:267/286 of query aligns to 4:273/291 of 5y8hA
- binding (2~{S})-2-methylpentanedioic acid: R144 (≠ L145), E148 (= E149), A151 (= A152), K153 (≠ A154)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G9 (= G9), N10 (≠ V10), M11 (= M11), F29 (≠ Y29), D30 (≠ N30), P31 (≠ R31), M63 (≠ C64), L64 (≠ V65), G120 (= G121), L239 (≠ W233), K242 (= K236)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
28% identity, 99% coverage: 2:284/286 of query aligns to 5:291/294 of 5je8B
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
31% identity, 99% coverage: 2:284/286 of query aligns to 3:287/287 of 3pefA
- binding glycerol: D67 (≠ N67), G123 (= G120), K171 (= K168), N175 (≠ Q172), M178 (≠ I175), L203 (= L200), G207 (≠ S204), N213 (≠ S210), A217 (≠ E214), F232 (= F229), H236 (≠ W233), K239 (= K236), R242 (≠ G239), R269 (≠ Q266)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G9), I11 (≠ V10), M12 (= M11), N31 (= N30), R32 (= R31), S33 (= S32), K36 (= K35), M64 (≠ C64), L65 (≠ V65), A66 (≠ G66), A70 (≠ D70), E73 (≠ D73), T96 (= T93), V121 (= V118), G123 (= G120), S124 (≠ G121), A231 (≠ G228), F232 (= F229), H236 (≠ W233), K239 (= K236)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
27% identity, 98% coverage: 5:285/286 of query aligns to 43:332/335 of P29266
- D68 (≠ N30) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K168) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q172) mutation to Q: Decrease in activity.
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
27% identity, 100% coverage: 1:285/286 of query aligns to 1:294/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), N10 (≠ V10), M11 (= M11), Y29 (= Y29), D30 (≠ N30), V31 (≠ R31), M63 (≠ C64), L64 (≠ V65), P65 (≠ G66), T95 (= T93), V120 (= V118), G122 (= G120), F238 (= F229), K245 (= K236)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
27% identity, 98% coverage: 5:285/286 of query aligns to 44:333/336 of P31937
- LP 103:104 (≠ VG 65:66) binding
- N108 (≠ D70) binding
- T134 (= T93) binding
- K284 (= K236) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
2uyyA Structure of the cytokine-like nuclear factor n-pac
28% identity, 97% coverage: 2:278/286 of query aligns to 8:286/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G9), L16 (≠ V10), M17 (= M11), N36 (= N30), R37 (= R31), T38 (≠ S32), V70 (= V65), S71 (≠ G66), A75 (≠ D70), T101 (= T93), F237 (= F229), Y238 (≠ A230), Y241 (≠ W233), K244 (= K236)
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
29% identity, 97% coverage: 2:278/286 of query aligns to 268:540/546 of Q922P9
- P489 (≠ F227) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
28% identity, 97% coverage: 2:278/286 of query aligns to 269:547/553 of Q49A26
- 271:285 (vs. 4:18, 33% identical) binding
- T362 (= T93) binding
- M437 (≠ I173) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (≠ F227) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K236) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
24% identity, 97% coverage: 5:281/286 of query aligns to 320:599/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
28% identity, 98% coverage: 4:283/286 of query aligns to 5:287/298 of P0A9V8
- QM 11:12 (≠ VM 10:11) binding
- D31 (≠ N30) binding
- L65 (≠ V65) binding
- T96 (= T93) binding
- G122 (≠ S119) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G120) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G121) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQIAI 171:175) binding
- K240 (= K236) binding
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
28% identity, 98% coverage: 4:283/286 of query aligns to 4:286/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), Q10 (≠ V10), M11 (= M11), F29 (≠ Y29), D30 (≠ N30), V31 (≠ R31), M63 (≠ C64), L64 (≠ V65), V73 (≠ L74), S94 (≠ T92), T95 (= T93), R122 (≠ G120)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
28% identity, 98% coverage: 4:283/286 of query aligns to 4:286/294 of 6smyA
Query Sequence
>CCNA_01645 FitnessBrowser__Caulo:CCNA_01645
MKTAFIGMGVMGFPMAGHLKAAGHEVAVYNRSPEKARRWAEKHGGAAFETIAEAVAGAEV
VLLCVGNDDDVRDLVAQVLPAMGEGGVIVDHTTTSAKVAREMAALAAQSGRAFVDAPVSG
GQAGAESGQLTIMAGGDQAAYDRVLPVIEVYAKAVRRIGEVGAGQLTKMCNQIAIAGVVQ
GVAEALHFAKRACLPTDDVLAAISKGAAQSWQMENRWPTMAQGKFDFGFAVDWMRKDLGI
ALDEARTNGAKLPATALIDQFYAEVQAMGGNRWDTSSLVARLEKDG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory