SitesBLAST
Comparing CCNA_01679 FitnessBrowser__Caulo:CCNA_01679 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u0mA Fatty aldehyde dehydrogenase from marinobacter aquaeolei vt8 and cofactor complex (see paper)
52% identity, 97% coverage: 1:470/485 of query aligns to 2:473/488 of 5u0mA
- active site: N148 (= N147), K171 (= K170), E246 (= E244), C280 (= C279), E377 (= E374), P455 (= P452)
- binding nicotinamide-adenine-dinucleotide: F144 (≠ L143), Y147 (≠ F146), N148 (= N147), K171 (= K170), S173 (= S172), E174 (= E173), G207 (= G206), T222 (= T220), G223 (= G221), S224 (= S222), V227 (≠ A225), E246 (= E244), M247 (≠ L245), G248 (= G246), C280 (= C279), E377 (= E374), F379 (= F376)
5u0lA X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate (see paper)
52% identity, 97% coverage: 1:470/485 of query aligns to 2:473/488 of 5u0lA
- active site: N148 (= N147), K171 (= K170), E246 (= E244), C280 (= C279), E377 (= E374), P455 (= P452)
- binding decanal: K107 (= K106), H152 (= H151), L153 (= L152), G156 (= G155), H157 (= H156), S456 (= S453), A457 (= A454)
3ju8A Crystal structure of succinylglutamic semialdehyde dehydrogenase from pseudomonas aeruginosa.
54% identity, 96% coverage: 6:473/485 of query aligns to 6:476/486 of 3ju8A
- active site: N147 (= N147), K170 (= K170), E245 (= E244), C279 (= C279), E377 (= E374), P455 (= P452)
- binding nicotinamide-adenine-dinucleotide: G144 (= G144), Y146 (≠ F146), N147 (= N147), L152 (= L152), K170 (= K170), S172 (= S172), F220 (= F219), T221 (= T220), G222 (= G221), S223 (= S222), T226 (≠ A225), E245 (= E244), M246 (≠ L245), G247 (= G246), C279 (= C279), E377 (= E374), F379 (= F376), F444 (= F441)
5izdA Wild-type glyceraldehyde dehydrogenase from thermoplasma acidophilum in complex with NADP
30% identity, 89% coverage: 1:431/485 of query aligns to 1:438/494 of 5izdA
- active site: N149 (= N147), K172 (= K170), E247 (= E244), C281 (= C279), E381 (= E374)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L145 (= L143), T146 (≠ G144), W148 (≠ F146), K172 (= K170), P173 (= P171), S174 (= S172), S175 (≠ E173), R204 (vs. gap), G205 (= G202), G209 (= G206), D210 (≠ Q207), G225 (= G221), S226 (= S222), T229 (≠ A225)
Sites not aligning to the query:
Q59931 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]; Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase; Triosephosphate dehydrogenase; EC 1.2.1.9 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see 3 papers)
30% identity, 91% coverage: 6:448/485 of query aligns to 8:451/475 of Q59931
- R103 (vs. gap) binding
- S151 (≠ G144) binding
- K177 (= K170) binding
- T180 (≠ E173) binding
- D215 (≠ Q207) binding
- 230:251 (vs. 221:245, 32% identical) binding
- E377 (= E374) binding
- R437 (≠ G434) binding
2esdA Crystal structure of thioacylenzyme intermediate of an NADP dependent aldehyde dehydrogenase (see paper)
30% identity, 91% coverage: 6:448/485 of query aligns to 7:450/474 of 2esdA
- active site: N153 (= N147), K176 (= K170), A249 (≠ E244), C283 (= C279), E376 (= E374)
- binding glyceraldehyde-3-phosphate: R102 (vs. gap), Y154 (≠ F148), R282 (= R278), C283 (= C279), T284 (≠ S280), Q435 (≠ T433), R436 (≠ G434)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F152 (= F146), K176 (= K170), P178 (≠ S172), T179 (≠ E173), G209 (= G202), G213 (= G206), D214 (≠ Q207), F227 (= F219), S230 (= S222), I233 (≠ A225), K328 (≠ R327), S329 (≠ A328), Y332 (≠ A331)
Sites not aligning to the query:
1qi1B Ternary complex of an NADP dependent aldehyde dehydrogenase (see paper)
30% identity, 91% coverage: 6:448/485 of query aligns to 7:450/474 of 1qi1B
- active site: N153 (= N147), K176 (= K170), E249 (= E244), S283 (≠ C279), E376 (= E374)
- binding sn-glycerol-3-phosphate: Y154 (≠ F148), R282 (= R278), S283 (≠ C279), T284 (≠ S280), R436 (≠ G434)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P151 (= P145), F152 (= F146), N153 (= N147), L158 (= L152), K176 (= K170), P178 (≠ S172), T179 (≠ E173), G209 (= G202), G213 (= G206), G229 (= G221), S230 (= S222), I233 (≠ A225), E249 (= E244), L250 (= L245), S283 (≠ C279)
Sites not aligning to the query:
7uyyA The crystal structure of the pseudomonas aeruginosa aldehyde dehydrogenase encoded by the pa4189 gene in complex with nadh (see paper)
34% identity, 91% coverage: 6:448/485 of query aligns to 24:471/496 of 7uyyA
- binding 1,4-dihydronicotinamide adenine dinucleotide: V165 (≠ L143), L166 (≠ G144), P167 (= P145), W168 (≠ F146), K192 (= K170), G225 (vs. gap), G229 (= G206), F243 (= F219), G245 (= G221), S246 (= S222), T249 (≠ A225), L252 (≠ Y228), F253 (= F229), Y256 (= Y232), C269 (≠ L245), G270 (= G246), C303 (= C279), H350 (≠ A328), K353 (≠ A331), F400 (= F376)
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
32% identity, 91% coverage: 13:451/485 of query aligns to 17:461/489 of 6wsbA
- active site: N152 (= N147), E250 (= E244), C284 (= C279)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ L143), G149 (= G144), A150 (≠ P145), W151 (≠ F146), N152 (= N147), K175 (= K170), E178 (= E173), G208 (≠ R203), G211 (= G206), A212 (≠ Q207), F225 (= F219), T226 (= T220), G227 (= G221), G228 (≠ S222), T231 (≠ A225), V235 (≠ F229), E250 (= E244), L251 (= L245), G252 (= G246), C284 (= C279), E385 (= E374), F387 (= F376)
Sites not aligning to the query:
3hazA Crystal structure of bifunctional proline utilization a (puta) protein (see paper)
35% identity, 89% coverage: 19:449/485 of query aligns to 523:956/983 of 3hazA
- active site: N652 (= N147), K675 (= K170), E752 (= E244), C786 (= C279), E878 (= E374)
- binding nicotinamide-adenine-dinucleotide: I648 (≠ L143), S649 (≠ G144), P650 (= P145), W651 (≠ F146), N652 (= N147), I657 (≠ L152), K675 (= K170), P676 (= P171), A677 (≠ S172), G708 (≠ R203), G711 (= G206), A712 (≠ Q207), T726 (= T220), G727 (= G221), S728 (= S222), V731 (≠ A225), I735 (≠ F229), E752 (= E244), T753 (≠ L245), C786 (= C279), E878 (= E374), F880 (= F376), F948 (= F441)
Sites not aligning to the query:
- active site: 960
- binding flavin-adenine dinucleotide: 272, 273, 306, 333, 335, 336, 337, 338, 339, 340, 358, 359, 360, 361, 364, 387, 388, 389, 390, 435, 460, 461
4o6rA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
34% identity, 95% coverage: 1:460/485 of query aligns to 2:469/489 of 4o6rA
- active site: N150 (= N147), K173 (= K170), E248 (= E244), C282 (= C279), E383 (= E374), E460 (≠ P452)
- binding adenosine monophosphate: I146 (≠ L143), V147 (≠ G144), K173 (= K170), G206 (= G202), G210 (= G206), Q211 (= Q207), F224 (= F219), G226 (= G221), S227 (= S222), T230 (≠ A225), R233 (= R231)
3rhhD Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from bacillus halodurans c-125 complexed with NADP
28% identity, 92% coverage: 1:448/485 of query aligns to 2:452/480 of 3rhhD
- active site: N155 (= N147), K178 (= K170), E251 (= E244), C285 (= C279), E378 (= E374)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I151 (≠ L143), P153 (= P145), F154 (= F146), K178 (= K170), P179 (= P171), A180 (≠ S172), T181 (≠ E173), G211 (= G202), G215 (= G206), D216 (≠ Q207), F229 (≠ S222), G231 (≠ A224), G232 (≠ A225), T235 (≠ Y228)
Sites not aligning to the query:
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
31% identity, 94% coverage: 6:460/485 of query aligns to 13:471/481 of 3jz4A
- active site: N156 (= N147), K179 (= K170), E254 (= E244), C288 (= C279), E385 (= E374), E462 (≠ P452)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (= P145), W155 (≠ F146), K179 (= K170), A181 (≠ S172), S182 (≠ E173), A212 (≠ R203), G216 (= G206), G232 (= G221), S233 (= S222), I236 (≠ A225), C288 (= C279), K338 (= K330), E385 (= E374), F387 (= F376)
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 94% coverage: 6:460/485 of query aligns to 14:472/482 of P25526
6bsnA Structure of proline utilization a (puta) with proline bound in remote sites (see paper)
35% identity, 86% coverage: 34:449/485 of query aligns to 528:947/973 of 6bsnA
- active site: N643 (= N147), E743 (= E244), A777 (≠ C279)
- binding proline: M630 (≠ H134), W642 (≠ F146), F644 (= F148), G718 (= G221), R776 (= R278), S778 (= S280), F871 (= F376), I930 (≠ T433), G931 (= G434), A932 (= A435), F939 (= F441)
Sites not aligning to the query:
- active site: 951
- binding dihydroflavine-adenine dinucleotide: 269, 270, 303, 330, 332, 333, 334, 335, 336, 337, 355, 356, 357, 358, 361, 384, 385, 386, 387, 432, 457, 458
- binding proline: 958, 959, 961
2eiwA Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound l-proline
31% identity, 94% coverage: 5:461/485 of query aligns to 40:503/516 of 2eiwA
- active site: N184 (= N147), K207 (= K170), E288 (= E244), C322 (= C279), E417 (= E374), T497 (≠ S453)
- binding proline: E137 (≠ S102), F185 (= F148), S323 (= S280), G477 (= G434), A478 (= A435), F485 (= F441)
4go4A Crystal structure of pnpe in complex with nicotinamide adenine dinucleotide
34% identity, 95% coverage: 1:460/485 of query aligns to 1:467/487 of 4go4A
- active site: N149 (= N147), K172 (= K170), E247 (= E244), C281 (= C279), E381 (= E374), E458 (≠ P452)
- binding nicotinamide-adenine-dinucleotide: I145 (≠ L143), V146 (≠ G144), W148 (≠ F146), N149 (= N147), F154 (≠ L152), K172 (= K170), G205 (= G202), G209 (= G206), Q210 (= Q207), F223 (= F219), T224 (= T220), G225 (= G221), S226 (= S222), T229 (≠ A225), E247 (= E244), G249 (= G246), C281 (= C279), E381 (= E374), F383 (= F376)
2j5nA 1-pyrroline-5-carboxylate dehydrogenase from thermus thermophirus with bound inhibitor glycine and NAD.
31% identity, 94% coverage: 5:461/485 of query aligns to 40:503/516 of 2j5nA
- active site: N184 (= N147), K207 (= K170), E288 (= E244), C322 (= C279), E417 (= E374), T497 (≠ S453)
- binding glycine: S323 (= S280), G477 (= G434), A478 (= A435), F485 (= F441)
- binding nicotinamide-adenine-dinucleotide: I180 (≠ L143), A181 (≠ G144), P182 (= P145), W183 (≠ F146), N184 (= N147), I189 (≠ L152), K207 (= K170), E210 (= E173), G240 (= G202), F258 (= F219), T259 (= T220), G260 (= G221), S261 (= S222), V264 (≠ A225), E288 (= E244), T289 (≠ L245), C322 (= C279), E417 (= E374), F419 (= F376)
2ej6A Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound d-proline
31% identity, 94% coverage: 5:461/485 of query aligns to 40:503/516 of 2ej6A
- active site: N184 (= N147), K207 (= K170), E288 (= E244), C322 (= C279), E417 (= E374), T497 (≠ S453)
- binding d-proline: E137 (≠ S102), F185 (= F148), S323 (= S280), G477 (= G434), A478 (= A435), F485 (= F441)
2eitA Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound l-alanine and NAD
31% identity, 94% coverage: 5:461/485 of query aligns to 40:503/516 of 2eitA
- active site: N184 (= N147), K207 (= K170), E288 (= E244), C322 (= C279), E417 (= E374), T497 (≠ S453)
- binding alanine: S323 (= S280), G477 (= G434), A478 (= A435), F485 (= F441)
- binding nicotinamide-adenine-dinucleotide: I180 (≠ L143), A181 (≠ G144), W183 (≠ F146), N184 (= N147), I189 (≠ L152), K207 (= K170), E210 (= E173), G240 (= G202), E241 (≠ R203), G244 (= G206), F258 (= F219), T259 (= T220), G260 (= G221), S261 (= S222), V264 (≠ A225), E288 (= E244), G290 (= G246), C322 (= C279), E417 (= E374), F419 (= F376)
Query Sequence
>CCNA_01679 FitnessBrowser__Caulo:CCNA_01679
MSGGLFIDGKWRAGQGAGLSSTDPATGEDVWSAATATPADVADAVAAARKAFPAWADRPR
EERIAILRRYKDILVERAAPYAEALSRETGKALWETRAELASMAGKVDLSIRAYDERTGV
TENAMPFGRAVLRHRAHGVMAVLGPFNFPGHLPNGHIVPALLAGDTVVFKPSEETPLAGQ
LMVEALEAAGAPAGVVNLVQGGRETGQALIAQDIDGLLFTGSAAAGTYFRRYFADRPDVI
LALELGGNNPLVVWNADDAPEAVAALIVQSAFITTGQRCSCARRLIVPDDASGAAIIEAT
VALAERLVIGAWNAENEPFMGPLISGRAAKAAREVASATPGKTILALDGVAGLGDAFLKP
GIVDVTGLETPDEELFAPLLQVRRVSSFDEALAAANATRYGLSAGLISNESELWDKFLSR
IRAGVVNWNRPTTGAAGSMPFGGLGASGNHRPSAYYAADYCAYPVASFEASMVVDTLKDI
KGLKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory