Comparing CCNA_01704 FitnessBrowser__Caulo:CCNA_01704 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00080 Cytochrome c2 from Rhodopila globiformis (Rhodopseudomonas globiformis) (see paper)
47% identity, 80% coverage: 24:119/120 of query aligns to 10:106/106 of P00080
P00031 Cytochrome c from Macrobrachium malcolmsonii (Monsoon river-prawn) (Palaemon malcolmsonii) (see paper)
48% identity, 76% coverage: 25:115/120 of query aligns to 7:99/105 of P00031
Sites not aligning to the query:
P00047 Cytochrome c from Thermomyces lanuginosus (Humicola lanuginosa) (see paper)
44% identity, 83% coverage: 22:120/120 of query aligns to 11:111/111 of P00047
1hroA Molecular structure of a high potential cytochrome c2 isolated from rhodopila globiformis (see paper)
47% identity, 80% coverage: 24:119/120 of query aligns to 9:105/105 of 1hroA
P00002 Cytochrome c from Macaca mulatta (Rhesus macaque) (see paper)
45% identity, 77% coverage: 24:115/120 of query aligns to 6:99/105 of P00002
Sites not aligning to the query:
P00038 Cytochrome c from Apis mellifera (Honeybee) (see paper)
44% identity, 80% coverage: 25:120/120 of query aligns to 11:108/108 of P00038
Sites not aligning to the query:
P00037 Cytochrome c from Samia cynthia (Ailanthus silkmoth) (Phalaena cynthia) (see paper)
45% identity, 83% coverage: 22:120/120 of query aligns to 8:108/108 of P00037
Sites not aligning to the query:
P00032 Cytochrome c from Cornu aspersum (Brown garden snail) (Helix aspersa) (see paper)
42% identity, 83% coverage: 22:120/120 of query aligns to 3:103/104 of P00032
P00014 Cytochrome c from Macropus giganteus (Eastern gray kangaroo) (see paper)
44% identity, 77% coverage: 24:115/120 of query aligns to 6:99/105 of P00014
Sites not aligning to the query:
P22342 Cytochrome c from Euglena viridis (Cercaria viridis) (see paper)
42% identity, 82% coverage: 22:119/120 of query aligns to 3:101/102 of P22342
Sites not aligning to the query:
6suvAaA Cytochrome c
43% identity, 77% coverage: 24:115/120 of query aligns to 5:98/104 of 6suvAaA
Sites not aligning to the query:
4rszA The x-ray structure of the primary adduct formed in the reaction between cisplatin and cytochromE C (see paper)
43% identity, 77% coverage: 24:115/120 of query aligns to 5:98/104 of 4rszA
1wejF Igg1 fab fragment (of e8 antibody) complexed with horse cytochromE C at 1.8 a resolution (see paper)
43% identity, 77% coverage: 24:115/120 of query aligns to 5:98/104 of 1wejF
1m60A Solution structure of zinc-substituted cytochromE C (see paper)
43% identity, 77% coverage: 24:115/120 of query aligns to 5:98/104 of 1m60A
1fi7A Solution structure of the imidazole complex of cytochromE C (see paper)
43% identity, 77% coverage: 24:115/120 of query aligns to 5:98/104 of 1fi7A
1akkA Solution structure of oxidized horse heart cytochromE C, nmr, minimized average structure (see paper)
43% identity, 77% coverage: 24:115/120 of query aligns to 5:98/104 of 1akkA
P00004 Cytochrome c from Equus caballus (Horse) (see 2 papers)
43% identity, 77% coverage: 24:115/120 of query aligns to 6:99/105 of P00004
Sites not aligning to the query:
P00017 Cytochrome c from Aptenodytes patagonicus (King penguin)
42% identity, 78% coverage: 25:117/120 of query aligns to 7:101/105 of P00017
Sites not aligning to the query:
P00022 Cytochrome c from Chelydra serpentina (Snapping turtle) (Testudo serpentina) (see paper)
41% identity, 79% coverage: 23:117/120 of query aligns to 5:101/105 of P00022
Sites not aligning to the query:
P81280 Cytochrome c from Alligator mississippiensis (American alligator) (see paper)
42% identity, 78% coverage: 25:117/120 of query aligns to 7:101/105 of P81280
Sites not aligning to the query:
>CCNA_01704 FitnessBrowser__Caulo:CCNA_01704
MMKVRLTLAAVFAALASGAVAAPSGQQLFEQRCGMCHSLQQAPGKMGPPLAGVVGRKAAS
FPGYTYSAALKGSGITWTADKLDAYSKAPTKVVPGTKMLLGAPNDAERAAVIAYLASVKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory