SitesBLAST
Comparing CCNA_01706 FitnessBrowser__Caulo:CCNA_01706 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
25% identity, 96% coverage: 15:568/579 of query aligns to 7:533/540 of 8jejA
- binding fe3-s4 cluster: R203 (= R216), C214 (= C235), C215 (≠ Q236), G216 (≠ Y237), N217 (≠ R238), N218 (= N239), N219 (≠ L240), C220 (= C241), C224 (= C245), I226 (≠ F247), M229 (≠ Y250), S341 (≠ R369)
- binding flavin-adenine dinucleotide: I11 (≠ V19), G12 (= G20), G14 (= G22), I15 (= I23), C16 (≠ T24), D35 (≠ E43), A36 (≠ R44), G97 (≠ N110), K100 (≠ R116), G101 (= G117), G104 (= G122), T105 (≠ R123), T106 (≠ S124), H108 (≠ T126), W109 (= W127), A110 (≠ G128), S112 (≠ Q130), M221 (≠ I242), A250 (≠ S273), V252 (= V275), A287 (= A312), N288 (≠ S313), E291 (≠ N316), N475 (≠ L508), H476 (= H511), N519 (= N554), T521 (≠ S556), M524 (≠ Y559)
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
25% identity, 96% coverage: 15:568/579 of query aligns to 4:530/537 of 7w2jD
- binding fe3-s4 cluster: R200 (= R216), C211 (= C235), G213 (≠ Y237), N214 (≠ R238), N215 (= N239), C217 (= C241), C221 (= C245), I223 (≠ F247), A225 (= A249), S338 (≠ R369)
- binding flavin-adenine dinucleotide: G9 (= G20), G11 (= G22), D32 (≠ E43), A33 (≠ R44), Y59 (≠ E75), K97 (≠ R116), G101 (= G122), T102 (≠ R123), T103 (≠ S124), H105 (≠ T126), W106 (= W127), S109 (≠ Q130), V249 (= V275), A284 (= A312), N285 (≠ S313), E288 (≠ N316), K291 (≠ W319), L292 (≠ I320), N472 (≠ L508), N516 (= N554), S517 (≠ P555), T518 (≠ S556)
- binding heme c: P209 (≠ T233), I223 (≠ F247)
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
26% identity, 94% coverage: 27:568/579 of query aligns to 14:525/531 of 8grjB
- binding fe3-s4 cluster: C204 (= C235), C205 (≠ Q236), G206 (≠ Y237), N207 (≠ R238), N209 (≠ L240), C210 (= C241), C214 (= C245), P331 (= P370)
- binding flavin-adenine dinucleotide: E30 (= E43), A31 (≠ R44), Q86 (≠ E109), R89 (= R116), T94 (≠ R123), H97 (≠ T126), W98 (= W127), A99 (≠ G128), S101 (≠ Q130), M211 (≠ I242), V242 (= V275), A277 (= A312), N278 (≠ S313), E281 (≠ N316), I285 (= I320), N467 (≠ L508), N511 (= N554), T513 (≠ S556)
- binding D-glucono-1,5-lactone: M211 (≠ I242), E333 (≠ D390), H355 (vs. gap), N466 (≠ G507), N467 (≠ L508), H468 (= H511), N511 (= N554)
Sites not aligning to the query:
4migA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type (see paper)
27% identity, 23% coverage: 438:571/579 of query aligns to 433:566/570 of 4migA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 128, 129, 130, 133, 134, 137, 138, 139, 141, 262, 302, 306
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 139, 407, 411, 415
4mifB Pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source (see paper)
27% identity, 23% coverage: 438:571/579 of query aligns to 444:577/581 of 4mifB
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 138, 142, 143, 146, 147, 148, 149, 150, 271, 312, 313, 316
4mihA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant (see paper)
27% identity, 23% coverage: 438:571/579 of query aligns to 439:572/576 of 4mihA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 22, 23, 24, 43, 44, 136, 137, 138, 141, 142, 146, 147, 149, 270, 310, 314
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 413, 417, 421
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
26% identity, 21% coverage: 446:567/579 of query aligns to 325:446/458 of 7qfdA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 14, 15, 16, 36, 37, 38, 101, 106, 107, 111, 112, 114, 210, 211, 246, 250
- binding alpha-D-glucopyranose: 77, 112
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
26% identity, 21% coverage: 446:567/579 of query aligns to 324:445/457 of 7qvaA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 36, 37, 38, 97, 102, 103, 106, 107, 108, 110, 206, 207, 241, 242, 243, 246
- binding Mangiferin: 51, 73, 108, 299
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
26% identity, 21% coverage: 446:567/579 of query aligns to 359:480/494 of 7qf8A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 37, 38, 114, 119, 120, 124, 125, 127, 227, 261, 262, 263, 266, 331
4mooA Pyranose 2-oxidase h450g mutant with 2-fluorinated galactose (see paper)
24% identity, 28% coverage: 406:569/579 of query aligns to 403:566/576 of 4mooA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 128, 129, 241, 278, 282
- binding 2-deoxy-2-fluoro-alpha-D-galactopyranose: 127
4momA Pyranose 2-oxidase h450g mutant with 3-fluorinated galactose (see paper)
24% identity, 28% coverage: 406:569/579 of query aligns to 403:566/576 of 4momA
Sites not aligning to the query:
- binding 3-deoxy-3-fluoro-beta-D-galactopyranose: 127
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 129, 241, 278
4moeA Pyranose 2-oxidase h450g mutant with 3-fluorinated glucose (see paper)
24% identity, 28% coverage: 406:569/579 of query aligns to 403:566/576 of 4moeA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 117, 121, 122, 125, 126, 127, 128, 129, 241, 278
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 127
4mofA Pyranose 2-oxidase h450g mutant with 2-fluorinated glucose (see paper)
24% identity, 28% coverage: 406:569/579 of query aligns to 400:563/573 of 4mofA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 114, 118, 119, 122, 123, 124, 126, 238, 275, 279
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: 124
Q6UG02 Pyranose 2-oxidase; P2Ox; POD; POx; PROD; Pyranose oxidase; FAD-oxidoreductase; Glucose 2-oxidase; Pyranose:oxygen 2-oxidoreductase; EC 1.1.3.10 from Phlebiopsis gigantea (White-rot fungus) (Peniophora gigantea) (see paper)
26% identity, 23% coverage: 438:569/579 of query aligns to 475:606/622 of Q6UG02
- E540 (≠ A505) mutation to K: In P2OxB1; increases thermostability up to 70 degrees Celsius and enhances pH stability in alkaline solution. Increases the catalytic efficiency 3.1-fold for D-xylose and 7.3-fold for L-sorbose, mainly by lowering the Km values for these two substrates to 6.6 mM and 5.4 mM, respectively. In P2OxB2H; increases the catalytic efficiency 5.3-fold for D-glucose, 2-fold for methyl-beta-D-glucoside, 59.9-fold for D-xylose, 69-fold for L-sorbose and 4.8-fold for D-galactose; when associated with K-312.
Sites not aligning to the query:
- 167 H→C: Decreases activity by 90%.
- 312 K→E: In P2OxB2H; increases the catalytic efficiency 5.3-fold for D-glucose, 2-fold for methyl-beta-D-glucoside, 59.9-fold for D-xylose, 69-fold for L-sorbose and 4.8-fold for D-galactose; when associated with K-540.
Query Sequence
>CCNA_01706 FitnessBrowser__Caulo:CCNA_01706
MANLNGRARRKNTYDAIVVGSGITGGIAAKELTEKGLKVLVLERGPMVRHLEDYPTAMLD
PWQSKYPQGKLPEAELNAHYKVQRRTGYTMTEQTQHFFVRDDEHPYTEENRFDWIRGYHV
GGRSLTWGRQSYRHSPIDFEANAREGIAVDWPIRYEDLAPWYEHVERFIGVSGQAEGLPH
FPDGHYQPPMELNCVEKAFKARSEARFPERRVTIGRTAHLTDPTEEQLALGRTKCQYRNL
CIRGCPFGAYYSSNSGGLIAAERTGNLVIRPNSIVTELIYDERAGRASGVRILDAETRKD
EEFHADVIFLCASALNSAWIMMNSTSSRFPNGFGNASDQLGRNVMDHHLGAGATGQAPEF
ADMYFSGRRPNGIYVPRFRNLGDAASKRSDYLRGFGYQGGAGRATWERDRGQGGRGFGAA
RKAALSQPGPWTMGLSGFGEMLPYADNRVTLNRDVEDKFGLPTLTMNVTMRDNEMAMRRD
MQAAAAEMLEAAGFQNVRAHDNGFAPGLGIHEMGTARMGRDPKTSVLNAHNQVHECKNVY
VTDGAAMASASCVNPSLTYMALTARAADHAVRARKRGEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory