Comparing CCNA_01800 FitnessBrowser__Caulo:CCNA_01800 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
61% identity, 72% coverage: 121:445/450 of query aligns to 26:354/359 of P11177
Sites not aligning to the query:
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
62% identity, 71% coverage: 127:445/450 of query aligns to 3:325/330 of 6cfoB
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
62% identity, 71% coverage: 127:445/450 of query aligns to 4:326/331 of 6cerD
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
40% identity, 71% coverage: 127:447/450 of query aligns to 2:321/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
40% identity, 71% coverage: 127:447/450 of query aligns to 2:321/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
40% identity, 71% coverage: 127:447/450 of query aligns to 2:321/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
40% identity, 71% coverage: 127:447/450 of query aligns to 2:321/324 of 1w85B
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
43% identity, 71% coverage: 128:445/450 of query aligns to 3:318/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
43% identity, 71% coverage: 128:445/450 of query aligns to 3:318/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
43% identity, 71% coverage: 128:445/450 of query aligns to 3:318/323 of 1umbD
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
43% identity, 71% coverage: 128:445/450 of query aligns to 4:319/324 of Q5SLR3
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
37% identity, 70% coverage: 124:436/450 of query aligns to 1:326/338 of 1qs0B
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
34% identity, 73% coverage: 116:445/450 of query aligns to 59:387/392 of P21953
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
34% identity, 71% coverage: 126:445/450 of query aligns to 3:321/326 of 1dtwB
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
34% identity, 71% coverage: 126:445/450 of query aligns to 6:324/329 of 2j9fD
G0S5Q0 Pyruvate dehydrogenase complex protein X component, mitochondrial; Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex; E3-binding protein; Pyruvate dehydrogenase complex component E3BP from Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) (Thermochaetoides thermophila) (see paper)
54% identity, 18% coverage: 3:81/450 of query aligns to 39:117/442 of G0S5Q0
Sites not aligning to the query:
O00330 Pyruvate dehydrogenase protein X component, mitochondrial; Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex; E3-binding protein; E3BP; Lipoyl-containing pyruvate dehydrogenase complex component X; proX from Homo sapiens (Human) (see 5 papers)
51% identity, 17% coverage: 4:81/450 of query aligns to 59:136/501 of O00330
Sites not aligning to the query:
A0A0D2Y5A7 Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial; FoDLAT; DLAT; EC 2.3.1.12 from Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) (Fusarium vascular wilt of tomato) (see paper)
52% identity, 17% coverage: 4:80/450 of query aligns to 39:115/457 of A0A0D2Y5A7
Sites not aligning to the query:
6yakDDD C-terminal component of the split chain transketolase (see paper)
26% identity, 61% coverage: 128:403/450 of query aligns to 3:264/311 of 6yakDDD
P10515 Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial; 70 kDa mitochondrial autoantigen of primary biliary cirrhosis; PBC; Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; M2 antigen complex 70 kDa subunit; Pyruvate dehydrogenase complex component E2; PDC-E2; PDCE2; EC 2.3.1.12 from Homo sapiens (Human) (see 4 papers)
47% identity, 17% coverage: 6:81/450 of query aligns to 96:171/647 of P10515
Sites not aligning to the query:
>CCNA_01800 FitnessBrowser__Caulo:CCNA_01800
MTDILMPALSPTMEEGTLAKWLVKEGDTIKAGDVIAEIETDKATMEVEAVDEGVIEAILV
PAGSENVKVNTLIARLKGDGEAAAPAVAAPVAEAATVVVAAPAAGGPISAASTFADPEIP
TGTALKKITVRDALRDAMAEEMRRDDRVFLMGEEVAQYQGAYKVSRELLQEFGDRRVIDT
PITEHGFAGMGVGAAMAGLKPIVEFMTWNFAMQAIDHIINSAAKTLYMSGGQIKSSIVFR
GPNGAASRVGAQHSQDYAAWYGNVPGLKVIAPYDAADAKGLLKAAIRDPNPVVFLEHEMM
YGHEFDIPDVEDWVVPIGKAKVRRQGSDVTLVAYSRMVGFALKAAEELEKEGIAAEVVDL
RTIRPMDHATILESVKKTNRLVTVEEGWGPMGVGAEIVARITEFGFDYLDAPPLRVCQED
VPLPYAANLEALSLPSVEKIVKAAKAVCYK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory