SitesBLAST
Comparing CCNA_01818 FitnessBrowser__Caulo:CCNA_01818 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
37% identity, 94% coverage: 8:278/287 of query aligns to 7:273/283 of P19938
- Y32 (= Y33) binding
- R51 (= R52) binding
- R99 (= R100) binding
- H101 (= H102) binding
- K146 (= K149) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (= E182) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (= L207) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
37% identity, 94% coverage: 8:278/287 of query aligns to 6:272/277 of 3daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (= Y33), R50 (= R52), K145 (= K149), E177 (= E182), S180 (= S185), S181 (= S186), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ G246), T241 (≠ A247)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
37% identity, 94% coverage: 8:278/287 of query aligns to 6:272/277 of 2daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (= Y33), V33 (= V35), R50 (= R52), R98 (= R100), H100 (= H102), K145 (= K149), E177 (= E182), S180 (= S185), S181 (= S186), N182 (= N187), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), T241 (≠ A247)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
37% identity, 94% coverage: 8:278/287 of query aligns to 6:272/277 of 1daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding pyridoxal-5'-phosphate: R50 (= R52), K145 (= K149), E177 (= E182), S180 (= S185), S181 (= S186), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ G246), T241 (≠ A247)
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
37% identity, 94% coverage: 8:278/287 of query aligns to 6:272/280 of 3lqsA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (= V35), R50 (= R52), E177 (= E182), S180 (= S185), S181 (= S186), N182 (= N187), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ G246), T241 (≠ A247), T242 (≠ G248)
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
37% identity, 94% coverage: 8:278/287 of query aligns to 6:272/282 of 1a0gB
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), A201 (≠ L207)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R52), K145 (= K149), E177 (= E182), S180 (= S185), S181 (= S186), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ G246), T241 (≠ A247)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
32% identity, 94% coverage: 4:274/287 of query aligns to 3:273/290 of 5mr0D
- active site: F32 (≠ Y33), G34 (≠ V35), K150 (= K149), E183 (= E182), L206 (= L207)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R52), G100 (≠ A103), L101 (≠ F104), K150 (= K149), Y154 (≠ L153), E183 (= E182), G186 (≠ S185), D187 (≠ S186), L206 (= L207), I209 (≠ V210), T210 (= T211), G245 (= G246), T246 (≠ A247)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
30% identity, 99% coverage: 4:287/287 of query aligns to 4:287/290 of 5e25A
- active site: F33 (≠ Y33), G35 (≠ V35), K151 (= K149), E184 (= E182), L207 (= L207)
- binding 2-oxoglutaric acid: Y88 (≠ L88), K151 (= K149), T247 (≠ A247), A248 (≠ G248)
- binding pyridoxal-5'-phosphate: R52 (= R52), K151 (= K149), Y155 (≠ L153), E184 (= E182), G187 (≠ S185), D188 (≠ S186), L207 (= L207), G209 (= G209), I210 (≠ V210), T211 (= T211), G246 (= G246), T247 (≠ A247)
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
32% identity, 96% coverage: 4:278/287 of query aligns to 17:291/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (≠ Y33), R65 (= R52), N166 (= N141), S202 (= S185), T203 (≠ S186), F222 (≠ L207), G224 (= G209), I225 (≠ V210), T226 (= T211), G261 (= G246), T262 (≠ A247)
4uugA The (r)-selective amine transaminase from aspergillus fumigatus with inhibitor bound (see paper)
27% identity, 98% coverage: 5:286/287 of query aligns to 29:312/320 of 4uugA
- active site: Y57 (= Y33), K178 (≠ Q139), E211 (= E182), L233 (= L207)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R76 (= R52), K178 (≠ Q139), E211 (= E182), G214 (≠ S185), F215 (≠ S186), N216 (= N187), L233 (= L207), G235 (= G209), I236 (≠ V210), T237 (= T211), T272 (≠ G246), T273 (≠ A247), A274 (≠ G248)
4chiA (R)-selective amine transaminase from aspergillus fumigatus at 1.27 a resolution (see paper)
27% identity, 98% coverage: 5:286/287 of query aligns to 29:312/320 of 4chiA
- active site: Y57 (= Y33), K178 (≠ Q139), E211 (= E182), L233 (= L207)
- binding pyridoxal-5'-phosphate: R76 (= R52), K178 (≠ Q139), E211 (= E182), F215 (≠ S186), L233 (= L207), G235 (= G209), I236 (≠ V210), T237 (= T211), T272 (≠ G246), T273 (≠ A247)
- binding phosphate ion: R76 (= R52), G235 (= G209), I236 (≠ V210), T237 (= T211), T273 (≠ A247)
8raiA Crystal structure of d-amino acid transaminase from haliscomenobacter hydrossis point mutant r90i complexed with phenylhydrazine
29% identity, 99% coverage: 1:283/287 of query aligns to 2:276/282 of 8raiA
- binding [6-methyl-5-oxidanyl-4-[(2-phenylhydrazinyl)methyl]pyridin-3-yl]methyl dihydrogen phosphate: F34 (≠ Y33), R53 (= R52), R138 (= R142), K144 (= K149), Y148 (≠ L153), E177 (= E182), A179 (= A184), R180 (≠ S185), S181 (= S186), N182 (= N187), L200 (= L207), G202 (= G209), I203 (≠ V210), T204 (= T211), T240 (≠ A247)
8ahuA Crystal structure of d-amino acid aminotrensferase from haliscomenobacter hydrossis complexed with d-cycloserine
29% identity, 99% coverage: 1:283/287 of query aligns to 3:277/283 of 8ahuA
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: F35 (≠ Y33), R54 (= R52), R139 (= R142), K145 (= K149), Y149 (≠ L153), E178 (= E182), A180 (= A184), R181 (≠ S185), S182 (= S186), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ G246), T241 (≠ A247)
7p7xA Crystal structure of d-amino acid transaminase from haliscomenobacter hydrossis (holo form). (see paper)
29% identity, 99% coverage: 1:283/287 of query aligns to 2:276/282 of 7p7xA
- binding pyridoxal-5'-phosphate: R53 (= R52), R138 (= R142), K144 (= K149), Y148 (≠ L153), E177 (= E182), A179 (= A184), R180 (≠ S185), S181 (= S186), L200 (= L207), G202 (= G209), I203 (≠ V210), T204 (= T211), T240 (≠ A247)
- binding phosphate ion: L47 (≠ A46), D48 (≠ E47), R73 (≠ T72)
Sites not aligning to the query:
7p3tB Transaminase of gamma-proteobacterium (see paper)
28% identity, 95% coverage: 6:278/287 of query aligns to 7:279/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R52), K153 (= K149), R157 (≠ L153), E186 (= E182), S187 (≠ G183), A188 (= A184), A189 (≠ S185), S190 (= S186), G210 (= G209), I211 (≠ V210), T212 (= T211), T248 (≠ A247)
6xu3C (R)-selective amine transaminase from shinella sp. (see paper)
30% identity, 94% coverage: 5:274/287 of query aligns to 30:300/322 of 6xu3C
- active site: Y58 (= Y33), K178 (≠ Q139), E211 (= E182), L233 (= L207)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: V60 (= V35), R77 (= R52), K178 (≠ Q139), F185 (≠ C146), E211 (= E182), G214 (≠ S185), N216 (= N187), L233 (= L207), G235 (= G209), V236 (= V210), T237 (= T211), T272 (= T245), T273 (≠ G246), A274 (= A247)
6xu3A (R)-selective amine transaminase from shinella sp. (see paper)
30% identity, 94% coverage: 5:274/287 of query aligns to 28:298/320 of 6xu3A
- active site: Y56 (= Y33), K176 (≠ Q139), E209 (= E182), L231 (= L207)
- binding pyridoxal-5'-phosphate: R75 (= R52), K176 (≠ Q139), F183 (≠ C146), E209 (= E182), G212 (≠ S185), F213 (≠ S186), L231 (= L207), G233 (= G209), V234 (= V210), T235 (= T211), T271 (≠ G246)
6xu3B (R)-selective amine transaminase from shinella sp. (see paper)
30% identity, 94% coverage: 5:274/287 of query aligns to 29:299/321 of 6xu3B
- active site: Y57 (= Y33), K177 (≠ Q139), E210 (= E182), L232 (= L207)
- binding 3-aminobenzoic acid: P169 (≠ Q131), D173 (≠ V135), K229 (≠ A204)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: R76 (= R52), Y112 (≠ L88), K177 (≠ Q139), F184 (≠ C146), E210 (= E182), G213 (≠ S185), F214 (≠ S186), N215 (= N187), L232 (= L207), G234 (= G209), V235 (= V210), T236 (= T211), T272 (≠ G246)
7dbeB Structure of a novel transaminase
29% identity, 95% coverage: 5:278/287 of query aligns to 41:316/332 of 7dbeB
- binding pyridoxal-5'-phosphate: R88 (= R52), K190 (= K149), E223 (= E182), G226 (≠ S185), F227 (≠ S186), N228 (= N187), L245 (= L207), G247 (= G209), I248 (≠ V210), T249 (= T211), T285 (≠ A247)
6fteB Crystal structure of an (r)-selective amine transaminase from exophiala xenobiotica
26% identity, 94% coverage: 5:274/287 of query aligns to 30:301/321 of 6fteB
- active site: Y58 (= Y33), K179 (≠ Q139), E212 (= E182), L234 (= L207)
- binding pyridoxal-5'-phosphate: R77 (= R52), K179 (≠ Q139), E212 (= E182), F216 (≠ S186), N217 (= N187), L234 (= L207), G236 (= G209), V237 (= V210), T238 (= T211), T274 (≠ A247)
Query Sequence
>CCNA_01818 FitnessBrowser__Caulo:CCNA_01818
MSRFAYVNGRFVRHGEAAVHIEDRGYQLADGVYEVWAVFDGKLADAEGHFARLWRSLDEL
RIAHPMSEAALTMVLREAVRRNKVREGLCYLQVTRGVARRDHAFPNPAVLPSVVVTARSL
DRAASEAKAAQGASVISVQENRWGRCDIKSIGLLPNALAKQAARERGAIEAWFVDDMGLV
TEGASSNAWIVDAEGALRTRDTNANILRGVTRYTLLDVIRESGMVINEKPFTIAEAQSAR
EAFITGAGSLVTPIVQVDGVKLGDGKPGPVAKRLRALYIERARQKAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory