Comparing CCNA_01835 FitnessBrowser__Caulo:CCNA_01835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
46% identity, 88% coverage: 28:227/228 of query aligns to 17:217/223 of 2pclA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
42% identity, 95% coverage: 11:227/228 of query aligns to 5:222/648 of P75831
7mdyC Lolcde nucleotide-bound
46% identity, 89% coverage: 27:228/228 of query aligns to 19:222/226 of 7mdyC
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
46% identity, 89% coverage: 27:228/228 of query aligns to 19:222/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
46% identity, 89% coverage: 27:228/228 of query aligns to 22:225/233 of P75957
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
46% identity, 89% coverage: 27:228/228 of query aligns to 21:224/229 of 7v8iD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
43% identity, 89% coverage: 27:228/228 of query aligns to 20:222/226 of 5xu1B
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
41% identity, 92% coverage: 20:228/228 of query aligns to 14:223/650 of 5ws4A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 94% coverage: 13:226/228 of query aligns to 4:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
40% identity, 94% coverage: 13:226/228 of query aligns to 4:223/230 of 1l2tA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
42% identity, 91% coverage: 22:228/228 of query aligns to 9:216/240 of 4ymuJ
8g4cB Bceabs atpgs high res tm (see paper)
33% identity, 88% coverage: 29:228/228 of query aligns to 22:223/248 of 8g4cB
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
38% identity, 89% coverage: 27:228/228 of query aligns to 20:222/615 of 5lilA
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
38% identity, 89% coverage: 27:228/228 of query aligns to 20:222/592 of 5lj7A
7tchB Bceab e169q variant atp-bound conformation (see paper)
32% identity, 88% coverage: 29:228/228 of query aligns to 21:222/245 of 7tchB
Sites not aligning to the query:
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 95% coverage: 11:227/228 of query aligns to 3:218/227 of 8igqA
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 95% coverage: 11:227/228 of query aligns to 3:218/225 of 8iddA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
42% identity, 95% coverage: 11:227/228 of query aligns to 2:217/229 of A5U7B7
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
43% identity, 92% coverage: 19:228/228 of query aligns to 7:216/241 of 4u00A
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
41% identity, 86% coverage: 30:226/228 of query aligns to 18:215/219 of 8w6iD
Sites not aligning to the query:
>CCNA_01835 FitnessBrowser__Caulo:CCNA_01835
MSDDVTPAAPLVLDAVALTLPSSAGPVNILRGVDLVVNPGERVAIIGPSGSGKSSLIAVG
AGLEEPTSGQVRLFGQDLAKLNEDGRARLRRGRAALVFQSFHLLPNMTAEENVATPLEID
GARDAMATARDWLGRVGLSGRLTHYPHQLSGGEQQRVALARALAARPALLFADEPTGNLD
GATATSVADLMFNLVTEVGAAMVMVTHDPVLATRADRIVRMADGRIVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory