SitesBLAST
Comparing CCNA_01884 FitnessBrowser__Caulo:CCNA_01884 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6af6A Piga with fad and proline (see paper)
28% identity, 98% coverage: 1:375/382 of query aligns to 1:379/383 of 6af6A
- active site: A127 (≠ D124), T128 (≠ A125), A244 (≠ D237), R377 (≠ A373)
- binding flavin-adenine dinucleotide: N125 (≠ L122), A127 (≠ D124), T128 (≠ A125), G133 (≠ R130), S134 (≠ F131), F158 (≠ H155), I159 (≠ A156), T160 (≠ L157), W211 (≠ N206), I363 (≠ M359), F364 (≠ A360), T367 (≠ N363), D369 (= D365), I370 (≠ H366)
- binding 1,4,7,10,13,16-hexaoxacyclooctadecane: L41 (≠ S43), K44 (≠ R46), K275 (≠ Q270), F280 (= F275)
- binding proline: G133 (≠ R130), I136 (≠ L133), F237 (≠ L232), M241 (≠ V236), S365 (≠ F361)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
28% identity, 96% coverage: 1:368/382 of query aligns to 1:369/379 of 1ukwB
- active site: L124 (≠ D124), S125 (≠ A125), T241 (≠ G239), E362 (≠ F361)
- binding cobalt (ii) ion: D145 (≠ G145), H146 (≠ G146)
- binding flavin-adenine dinucleotide: F122 (≠ L122), L124 (≠ D124), S125 (≠ A125), G130 (≠ R130), S131 (≠ F131), W155 (≠ H155), S157 (≠ L157), K200 (vs. gap), L357 (≠ M356), Y361 (≠ A360), E362 (≠ F361), T364 (≠ N363), E366 (≠ D365)
Sites not aligning to the query:
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
28% identity, 96% coverage: 1:368/382 of query aligns to 1:369/379 of 1ukwA
- active site: L124 (≠ D124), S125 (≠ A125), T241 (≠ G239), E362 (≠ F361)
- binding flavin-adenine dinucleotide: F122 (≠ L122), L124 (≠ D124), S125 (≠ A125), G130 (≠ R130), S131 (≠ F131), W155 (≠ H155), S157 (≠ L157), L357 (≠ M356), Y361 (≠ A360), E362 (≠ F361), T364 (≠ N363), E366 (≠ D365)
Sites not aligning to the query:
6cxtB Crystal structure of fad-dependent dehydrogenase (see paper)
26% identity, 98% coverage: 1:375/382 of query aligns to 1:369/372 of 6cxtB
- active site: I117 (≠ D124), S118 (≠ A125), E234 (≠ G239), N367 (≠ A373)
- binding flavin-adenine dinucleotide: N115 (≠ L122), I117 (≠ D124), S118 (≠ A125), G123 (≠ R130), S124 (≠ F131), Y148 (≠ H155), T150 (≠ L157), L201 (= L209), F354 (≠ A360), T357 (≠ N363), D359 (= D365), I360 (≠ H366)
- binding S-[2-({N-[(2R)-2-hydroxy-4-{[(R)-hydroxy(oxo)-lambda~5~-phosphanyl]oxy}-3,3-dimethylbutanoyl]-beta-alanyl}amino)ethyl] 1H-pyrrole-2-carbothioate: A81 (≠ V88), N115 (≠ L122), S124 (≠ F131), F227 (≠ L232), M231 (≠ V236), E234 (≠ G239), R235 (≠ V240), F354 (≠ A360), S355 (≠ F361), G356 (= G362), I360 (≠ H366)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
29% identity, 92% coverage: 1:353/382 of query aligns to 1:355/380 of 4l1fA
- active site: L125 (≠ D124), T126 (≠ A125), G242 (= G239)
- binding coenzyme a persulfide: T132 (≠ F131), H179 (≠ D179), F232 (= F229), M236 (≠ R233), E237 (≠ D234), L239 (≠ V236), D240 (= D237), R243 (≠ V240)
- binding flavin-adenine dinucleotide: F123 (≠ L122), L125 (≠ D124), T126 (≠ A125), G131 (≠ R130), T132 (≠ F131), F156 (≠ H155), I157 (≠ A156), T158 (≠ L157), R268 (= R265), Q270 (= Q267), F271 (= F268), I275 (≠ L272), F278 (= F275), L281 (= L278), Q336 (= Q334), I337 (≠ L335), G340 (= G338)
- binding 1,3-propandiol: L5 (= L5), Q10 (= Q10)
Sites not aligning to the query:
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
29% identity, 85% coverage: 51:375/382 of query aligns to 41:367/369 of 3pfdC
- active site: L116 (≠ D124), S117 (≠ A125), T233 (≠ G239), E353 (≠ F361), R365 (≠ A373)
- binding dihydroflavine-adenine dinucleotide: Y114 (≠ L122), L116 (≠ D124), S117 (≠ A125), G122 (≠ R130), S123 (≠ F131), W147 (≠ H155), I148 (≠ A156), T149 (≠ L157), R259 (= R265), F262 (= F268), V266 (≠ L272), N269 (≠ F275), Q326 (= Q334), L327 (= L335), G330 (= G338), I348 (≠ M356), Y352 (≠ A360), T355 (≠ N363), Q357 (≠ D365)
6cy8B Crystal structure of fad-dependent dehydrogenase (see paper)
26% identity, 98% coverage: 1:375/382 of query aligns to 1:367/370 of 6cy8B
- active site: I115 (≠ D124), S116 (≠ A125), E232 (≠ G239), N365 (≠ A373)
- binding flavin-adenine dinucleotide: N113 (≠ L122), I115 (≠ D124), S116 (≠ A125), G121 (≠ R130), S122 (≠ F131), Y146 (≠ H155), T148 (≠ L157), L199 (= L209), L351 (≠ M359), F352 (≠ A360), T355 (≠ N363), D357 (= D365), I358 (≠ H366)
- binding 4'-phosphopantetheine: S122 (≠ F131), F225 (≠ L232), A226 (≠ R233), R233 (≠ V240), S353 (≠ F361), G354 (= G362)
2dvlA Crystal structure of project tt0160 from thermus thermophilus hb8
28% identity, 97% coverage: 5:375/382 of query aligns to 1:368/370 of 2dvlA
- active site: L121 (≠ D124), T122 (≠ A125), G233 (= G239), E354 (≠ F361), R366 (≠ A373)
- binding flavin-adenine dinucleotide: L121 (≠ D124), T122 (≠ A125), G127 (≠ R130), S128 (≠ F131), W152 (≠ H155), I153 (≠ A156), T154 (≠ L157), T356 (≠ N363), E358 (≠ D365)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
28% identity, 84% coverage: 33:352/382 of query aligns to 28:349/374 of 5lnxD
- active site: L122 (≠ D124), T123 (≠ A125), G239 (= G239)
- binding flavin-adenine dinucleotide: L122 (≠ D124), T123 (≠ A125), G128 (≠ R130), S129 (≠ F131), F153 (≠ H155), T155 (≠ L157), R265 (= R265), Q267 (= Q267), F268 (= F268), I272 (≠ L272), N275 (≠ F275), I278 (≠ L278), Q331 (= Q334), I332 (≠ L335), G335 (= G338)
Sites not aligning to the query:
8sgrA Isovaleryl-CoA dehydrogenase, mitochondrial (see paper)
25% identity, 95% coverage: 5:367/382 of query aligns to 12:393/393 of 8sgrA
- binding flavin-adenine dinucleotide: S135 (≠ A125), G140 (≠ R130), S141 (≠ F131), W165 (≠ H155), T167 (≠ L157), R279 (= R265), F282 (= F268), I286 (≠ L272), F289 (= F275), Q347 (= Q334), C348 (≠ L335), G351 (= G338), L369 (vs. gap), G375 (vs. gap), T376 (vs. gap), L382 (≠ I355)
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
25% identity, 95% coverage: 5:367/382 of query aligns to 45:426/426 of P26440
- 165:174 (vs. 122:131, 50% identical) binding
- S174 (≠ F131) binding
- WIT 198:200 (≠ HAL 155:157) binding
- SR 222:223 (≠ QD 178:179) binding
- G250 (≠ N203) to A: in IVA; uncertain significance
- Y277 (≠ P230) binding
- DLER 284:287 (≠ DRGV 237:240) binding
- E286 (≠ G239) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (≠ L244) to V: in IVA; uncertain significance; dbSNP:rs886042098
- R312 (= R265) binding
- Q323 (= Q276) binding
- I379 (≠ V333) to T: in IVA; uncertain significance
- QCFGG 380:384 (≠ QLHGG 334:338) binding
- R398 (≠ K352) to Q: in IVA; uncertain significance; dbSNP:rs1477527791
- Y403 (vs. gap) to N: in IVA; uncertain significance
- A407 (vs. gap) mutation to E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- AG 407:408 (vs. gap) binding
- TSE 409:411 (vs. gap) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
25% identity, 95% coverage: 5:368/382 of query aligns to 8:377/387 of 1ivhA
- active site: M130 (≠ D124), S131 (≠ A125), E249 (≠ G239), A370 (≠ F361)
- binding coenzyme a persulfide: S137 (≠ F131), S185 (≠ Q178), R186 (≠ D179), V239 (≠ F229), Y240 (≠ P230), M243 (≠ R233), E249 (≠ G239), R250 (≠ V240), G369 (≠ A360), A370 (≠ F361), G371 (= G362), V375 (≠ H366)
- binding flavin-adenine dinucleotide: L128 (= L122), M130 (≠ D124), S131 (≠ A125), G136 (≠ R130), S137 (≠ F131), W161 (≠ H155), T163 (≠ L157), R275 (= R265), F278 (= F268), F285 (= F275), M288 (≠ L278), Q343 (= Q334), C344 (≠ L335), G347 (= G338), T372 (≠ N363), E374 (≠ D365)
Sites not aligning to the query:
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
24% identity, 98% coverage: 2:375/382 of query aligns to 4:379/384 of 1jqiA
- active site: G377 (≠ A373)
- binding acetoacetyl-coenzyme a: L95 (vs. gap), F125 (≠ L122), S134 (≠ F131), F234 (= F229), M238 (≠ R233), Q239 (≠ D234), L241 (≠ V236), D242 (= D237), R245 (≠ V240), Y364 (≠ A360), E365 (≠ F361), G366 (= G362)
- binding flavin-adenine dinucleotide: F125 (≠ L122), L127 (≠ D124), S128 (≠ A125), G133 (≠ R130), S134 (≠ F131), W158 (≠ H155), T160 (≠ L157), R270 (= R265), F273 (= F268), L280 (≠ F275), Q338 (= Q334), I339 (≠ L335), G342 (= G338), I360 (≠ M356), T367 (≠ N363), E369 (≠ D365), I370 (≠ H366)
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 98% coverage: 2:375/382 of query aligns to 31:406/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
32% identity, 66% coverage: 102:352/382 of query aligns to 106:358/383 of 1bucA
- active site: L128 (≠ D124), T129 (≠ A125), G246 (= G239)
- binding acetoacetyl-coenzyme a: F126 (≠ L122), G134 (≠ R130), T135 (≠ F131), T162 (≠ L157), N182 (≠ S177), H183 (≠ Q178), F236 (= F229), M240 (≠ R233), M241 (≠ D234), L243 (≠ V236), D244 (= D237), T317 (≠ K312)
- binding flavin-adenine dinucleotide: F126 (≠ L122), L128 (≠ D124), T129 (≠ A125), G134 (≠ R130), T135 (≠ F131), F160 (≠ H155), T162 (≠ L157)
Sites not aligning to the query:
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
32% identity, 66% coverage: 102:352/382 of query aligns to 106:358/383 of Q06319
Sites not aligning to the query:
- 367 active site, Proton acceptor; E→Q: Loss of activity.
7w0jE Acyl-coa dehydrogenase, tfu_1647
27% identity, 98% coverage: 2:375/382 of query aligns to 1:380/382 of 7w0jE
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: S127 (≠ A125), W157 (≠ H155), R270 (= R265), Q272 (= Q267), F273 (= F268), I277 (≠ L272), F280 (= F275), I283 (≠ L278), Q339 (= Q334), L340 (= L335), G343 (= G338), Y365 (≠ A360), E366 (≠ F361), T368 (≠ N363), Q370 (≠ D365), I371 (≠ H366)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
26% identity, 97% coverage: 6:375/382 of query aligns to 5:376/378 of 5ol2F
- active site: L124 (≠ D124), T125 (≠ A125), G241 (= G239), G374 (≠ A373)
- binding calcium ion: E29 (≠ R32), E33 (≠ G36), R35 (≠ A38)
- binding coenzyme a persulfide: L238 (≠ V236), R242 (≠ V240), E362 (≠ F361), G363 (= G362)
- binding flavin-adenine dinucleotide: F122 (≠ L122), L124 (≠ D124), T125 (≠ A125), P127 (= P127), T131 (≠ F131), F155 (≠ H155), I156 (≠ A156), T157 (≠ L157), E198 (≠ S198), R267 (= R265), F270 (= F268), L274 (= L272), F277 (= F275), Q335 (= Q334), L336 (= L335), G338 (= G337), G339 (= G338), Y361 (≠ A360), T364 (≠ N363), E366 (≠ D365)
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
27% identity, 98% coverage: 3:375/382 of query aligns to 1:379/381 of 8i4rA
- binding acetyl coenzyme *a: S132 (≠ F131), T134 (≠ L133), R180 (≠ D179), R234 (≠ P230), L237 (≠ R233), R238 (≠ D234), L240 (≠ V236), D241 (= D237), R244 (≠ V240), E365 (≠ F361), G366 (= G362), R377 (≠ A373)
- binding flavin-adenine dinucleotide: Y123 (≠ L122), L125 (≠ D124), S126 (≠ A125), G131 (≠ R130), S132 (≠ F131), W156 (≠ H155), I157 (≠ A156), T158 (≠ L157), I360 (≠ M356), T367 (≠ N363), Q369 (≠ D365)
8i4pA Crystal structure of acyl-coa dehydrogenase from thermobifida fusca
27% identity, 98% coverage: 3:375/382 of query aligns to 1:379/381 of 8i4pA
- binding flavin-adenine dinucleotide: Y123 (≠ L122), L125 (≠ D124), S126 (≠ A125), G131 (≠ R130), S132 (≠ F131), W156 (≠ H155), I157 (≠ A156), T158 (≠ L157), I360 (≠ M356), Y364 (≠ A360), T367 (≠ N363), Q369 (≠ D365)
Query Sequence
>CCNA_01884 FitnessBrowser__Caulo:CCNA_01884
MNFDLSEEQQLLKDSARRYGADHGDFTAWRARVERGEAYDAASWRRMADLGWLMLNVPED
DGGLGAGPTETMVVAEAVGRYLMLVPFVSTGVIAPTLLTAATEALRAHLMAGLAEGKLVI
SLADAEPNGRFDLNRIATRAEAVEGGFRLTGAKSHALDGGAADWFIVPARTTAADDSQDG
VSLFLVPAEIEGLTVMRSRAMDNRHNASLKLDGVVVPAANLIGGLGEGFPLLRDAVDRGV
VARLAEAVGAMDAVREMTMEYLKTRKQFGQTLGAFQALQHRAVDMAIACEEARSMMYLAT
LALSGAPVERRKVIAAAKARVGQTSLYVGRQAVQLHGGVGFTEELAVAHYLKRLIMIDMA
FGNADHHRAELAASLRPGAVAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory