SitesBLAST
Comparing CCNA_01885 FitnessBrowser__Caulo:CCNA_01885 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
40% identity, 93% coverage: 14:253/258 of query aligns to 3:253/256 of 1gegE
- active site: G13 (= G24), S139 (= S149), Y152 (= Y162), K156 (= K166), V197 (= V204)
- binding alpha-D-glucopyranose: R63 (= R74), D64 (≠ E75), F67 (≠ T78), E123 (≠ P134)
- binding nicotinamide-adenine-dinucleotide: G9 (= G20), Q12 (≠ R23), I14 (≠ L25), D33 (= D44), Y34 (≠ L45), V58 (≠ C69), D59 (= D70), V60 (= V71), N86 (= N97), A87 (= A98), I109 (≠ V120), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), V185 (= V195), T187 (= T197), M189 (vs. gap)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
40% identity, 93% coverage: 14:253/258 of query aligns to 3:253/256 of Q48436
- 6:33 (vs. 17:44, 46% identical) binding
- D59 (= D70) binding
- K156 (= K166) binding
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 95% coverage: 10:253/258 of query aligns to 4:242/244 of 4nbuB
- active site: G18 (= G24), N111 (≠ G121), S139 (= S149), Q149 (≠ G159), Y152 (= Y162), K156 (= K166)
- binding acetoacetyl-coenzyme a: D93 (≠ Y103), K98 (≠ A108), S139 (= S149), N146 (≠ I156), V147 (≠ P157), Q149 (≠ G159), Y152 (= Y162), F184 (≠ T194), M189 (≠ G199), K200 (≠ M211)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), N17 (≠ R23), G18 (= G24), I19 (≠ L25), D38 (= D44), F39 (≠ W49), V59 (≠ C69), D60 (= D70), V61 (= V71), N87 (= N97), A88 (= A98), G89 (≠ M99), I90 (≠ W100), T137 (≠ I147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), F184 (≠ T194), T185 (≠ V195), T187 (= T197), M189 (≠ G199)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 94% coverage: 11:253/258 of query aligns to 3:245/248 of 4urfB
- active site: G16 (= G24), S142 (= S149), I152 (≠ G159), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L218), R211 (≠ G219), R212 (= R220)
- binding bicarbonate ion: I92 (≠ M99), G94 (≠ N101), R109 (= R116), R179 (= R186), S228 (≠ C236)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), G14 (≠ S22), N15 (≠ R23), G16 (= G24), I17 (≠ L25), D36 (= D44), I37 (≠ L45), D62 (= D70), T63 (≠ V71), N89 (= N97), A90 (= A98), G91 (vs. gap), I140 (= I147), Y155 (= Y162), K159 (= K166), P185 (= P192), A186 (≠ S193), I188 (≠ V195), T190 (= T197)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 94% coverage: 11:253/258 of query aligns to 3:245/248 of 4urfA
- active site: G16 (= G24), S142 (= S149), I152 (≠ G159), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ M99), S93 (≠ W100), G94 (≠ N101), E95 (≠ V102), T97 (≠ E104), E101 (≠ A108), T103 (≠ R110), Q106 (≠ S113), R109 (= R116), S175 (≠ A182), G177 (≠ N184)
- binding magnesium ion: S237 (≠ Q245), Y238 (≠ M246)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), G14 (≠ S22), N15 (≠ R23), G16 (= G24), I17 (≠ L25), D36 (= D44), I37 (≠ L45), W41 (= W49), D62 (= D70), T63 (≠ V71), N89 (= N97), A90 (= A98), G91 (vs. gap), I140 (= I147), Y155 (= Y162), K159 (= K166), P185 (= P192), I188 (≠ V195), T190 (= T197)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 94% coverage: 11:253/258 of query aligns to 3:245/248 of 4ureB
- active site: G16 (= G24), S142 (= S149), I152 (≠ G159), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ R23), G16 (= G24), I17 (≠ L25), N89 (= N97), G91 (vs. gap), Y155 (= Y162), P185 (= P192), A186 (≠ S193)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
39% identity, 94% coverage: 11:253/258 of query aligns to 3:241/244 of 7krmC
- active site: G18 (= G24), S140 (= S149), Y155 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S15 (vs. gap), G18 (= G24), I19 (≠ L25), D38 (= D44), L39 (= L45), A60 (≠ C69), N61 (≠ D70), V62 (= V71), N88 (= N97), V111 (= V120), S140 (= S149), Y155 (= Y162), K159 (= K166), I188 (≠ V195), T190 (= T197)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
40% identity, 95% coverage: 10:253/258 of query aligns to 8:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G20), S20 (= S22), K21 (≠ R23), G22 (= G24), I23 (≠ L25), A43 (≠ H48), S44 (≠ W49), S45 (≠ A50), G68 (≠ C69), D69 (= D70), V70 (= V71), N96 (= N97), S97 (≠ A98), G98 (≠ M99), Y100 (≠ N101), I144 (= I147), S146 (= S149), Y159 (= Y162), K163 (= K166), P189 (= P192), G190 (≠ S193), M191 (≠ T194), I192 (≠ V195), T194 (= T197), G196 (= G199), T197 (≠ V200)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S149), Y159 (= Y162), M191 (≠ T194), I202 (≠ V203)
5epoA The three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase (see paper)
38% identity, 95% coverage: 10:254/258 of query aligns to 2:249/261 of 5epoA
- active site: G16 (= G24), T144 (≠ S149), I152 (≠ P157), Y157 (= Y162), K161 (= K166), R193 (≠ E198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S12 (≠ G20), T14 (≠ S22), R15 (= R23), G16 (= G24), I17 (≠ L25), R37 (≠ L45), F61 (≠ C69), N62 (≠ D70), N89 (= N97), Y90 (vs. gap), G91 (vs. gap), Y157 (= Y162), K161 (= K166), P187 (= P192), G188 (≠ S193), I190 (≠ V195), T192 (= T197), R193 (≠ E198), A194 (≠ G199), A195 (≠ V200)
- binding taurochenodeoxycholic acid: T93 (≠ A98), T144 (≠ S149), G146 (≠ S151), R154 (≠ G159), Y157 (= Y162), G188 (≠ S193), N198 (≠ V203), M199 (≠ V204), F203 (≠ R208)
G9FRD7 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NADP-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.- from Clostridium sardiniense (Clostridium absonum) (see 2 papers)
38% identity, 95% coverage: 10:254/258 of query aligns to 3:250/262 of G9FRD7
- SSTRGI 13:18 (≠ GASRGL 20:25) binding
- R38 (≠ L45) binding ; mutation to D: Loss of catalytic activity.
- NA 63:64 (≠ DV 70:71) binding
- N90 (= N97) binding
- T145 (≠ S149) binding
- Y158 (= Y162) binding ; binding
- K162 (= K166) binding
- IGTRA 191:195 (≠ VDTEG 195:199) binding
Sites not aligning to the query:
- 261:262 mutation Missing: 5-fold reduction in catalytic efficiency.
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
36% identity, 95% coverage: 10:253/258 of query aligns to 2:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), Q15 (≠ R23), G16 (= G24), I17 (≠ L25), D36 (= D44), V63 (= V71), N89 (= N97), A91 (vs. gap), S94 (≠ N101), I142 (= I147), S143 (≠ A148), S144 (= S149), Y157 (= Y162), K161 (= K166), P187 (= P192), H188 (≠ S193), I190 (≠ V195), I194 (≠ G199)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
36% identity, 95% coverage: 9:253/258 of query aligns to 1:245/248 of 6ixmC
- active site: G16 (= G24), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S15 (≠ R23), G16 (= G24), I17 (≠ L25), D36 (= D44), I37 (≠ L45), A61 (≠ C69), D62 (= D70), T63 (≠ V71), N89 (= N97), A90 (= A98), M140 (≠ I147), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), A186 (≠ S193), Y187 (≠ T194), I188 (≠ V195), L192 (≠ G199)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
38% identity, 94% coverage: 11:252/258 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G20), M16 (≠ L25), D35 (= D44), I36 (≠ L45), I62 (≠ V71), N88 (= N97), G90 (≠ M99), I138 (= I147), S140 (= S149), Y152 (= Y162), K156 (= K166), I185 (≠ V195)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
38% identity, 94% coverage: 11:252/258 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ R23) binding
- D36 (= D44) binding
- D62 (= D70) binding
- I63 (≠ V71) binding
- N89 (= N97) binding
- Y153 (= Y162) binding
- K157 (= K166) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
37% identity, 94% coverage: 10:252/258 of query aligns to 3:253/257 of 6pejA
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 94% coverage: 11:253/258 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G24), S142 (= S149), Q152 (≠ G159), Y155 (= Y162), K159 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (= S22), R15 (= R23), G16 (= G24), I17 (≠ L25), N35 (vs. gap), Y36 (≠ L43), N37 (≠ D44), G38 (≠ L45), S39 (≠ K46), N63 (≠ D70), V64 (= V71), N90 (= N97), A91 (= A98), I93 (≠ W100), I113 (≠ V120), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), I188 (≠ V195), T190 (= T197)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
35% identity, 95% coverage: 10:253/258 of query aligns to 5:245/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G20), R18 (= R23), G19 (= G24), I20 (≠ L25), D39 (= D44), R40 (≠ L45), C63 (= C69), I65 (≠ V71), N91 (= N97), G93 (≠ M99), I94 (≠ W100), V114 (= V120), Y155 (= Y162), K159 (= K166), I188 (≠ V195), T190 (= T197), T193 (≠ R201)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
40% identity, 96% coverage: 11:257/258 of query aligns to 3:251/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), G16 (= G24), I17 (≠ L25), D36 (= D44), L37 (= L45), C61 (= C69), D62 (= D70), V63 (= V71), N89 (= N97), A90 (= A98), T140 (≠ I147), S142 (= S149), Y155 (= Y162), K159 (= K166), A186 (≠ S193), V187 (≠ T194)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 94% coverage: 11:253/258 of query aligns to 6:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (= S22), R18 (= R23), I20 (≠ L25), T40 (≠ L45), N62 (≠ D70), V63 (= V71), N89 (= N97), A90 (= A98), I92 (≠ W100), V139 (≠ I147), S141 (= S149), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (≠ S193), I187 (≠ V195), T189 (= T197), M191 (≠ G199)
4bo9A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 5-(2-(furan-2-ylmethoxy) phenyl)-2-phenyltetrazole at 2.9a resolution (see paper)
39% identity, 94% coverage: 11:253/258 of query aligns to 5:232/235 of 4bo9A
Query Sequence
>CCNA_01885 FitnessBrowser__Caulo:CCNA_01885
MREEGTMAGRLEGRVAAVTGASRGLGRATAALLAAEGAMVALLDLKAHWAQAAADEIIAA
GGKAVGLGCDVSDREALTATLGAVNDAHGRFDVLVNNAMWNVYEPLAAIRPESLDRMVSV
GFSGVIWGMQAAAPLMAASGGGSIVNIASVSAQLGIPNGIAYCGVKAGVAGMTRAAAAEL
GAMNIRVNAVAPSTVDTEGVRRVVSEERIAMRIGQTPLGRLGTTEDIAKAVRYLACDDSD
FVTGQMLTVDGGLATALS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory