SitesBLAST
Comparing CCNA_01892 FitnessBrowser__Caulo:CCNA_01892 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
39% identity, 45% coverage: 31:274/546 of query aligns to 5:250/252 of 1vl8B
- active site: G17 (= G43), S143 (= S167), I154 (≠ R177), Y157 (= Y180), K161 (= K184)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G39), R16 (≠ D42), G17 (= G43), L18 (≠ I44), S37 (≠ D63), R38 (= R64), C63 (≠ M85), D64 (= D86), V65 (= V87), A91 (≠ N113), A92 (= A114), G93 (= G115), I94 (≠ V116), V114 (≠ I138), I141 (≠ L165), S143 (= S167), Y157 (= Y180), K161 (= K184), P187 (= P210), G188 (= G211), Y190 (≠ T213), T192 (= T215), M194 (= M217), T195 (≠ V218)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 45% coverage: 28:272/546 of query aligns to 3:241/244 of 4nbuB
- active site: G18 (= G43), N111 (= N139), S139 (= S167), Q149 (≠ R177), Y152 (= Y180), K156 (= K184)
- binding acetoacetyl-coenzyme a: D93 (≠ P119), K98 (≠ T124), S139 (= S167), N146 (≠ L174), V147 (≠ A175), Q149 (≠ R177), Y152 (= Y180), F184 (≠ Y212), M189 (= M217), K200 (≠ R235)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G39), N17 (≠ D42), G18 (= G43), I19 (= I44), D38 (= D63), F39 (≠ R64), V59 (≠ M85), D60 (= D86), V61 (= V87), N87 (= N113), A88 (= A114), G89 (= G115), I90 (≠ V116), T137 (≠ L165), S139 (= S167), Y152 (= Y180), K156 (= K184), P182 (= P210), F184 (≠ Y212), T185 (= T213), T187 (= T215), M189 (= M217)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
36% identity, 46% coverage: 26:274/546 of query aligns to 1:259/261 of 6zzsD
- active site: G18 (= G43), S143 (= S167), Y156 (= Y180)
- binding nicotinamide-adenine-dinucleotide: G14 (= G39), S17 (≠ D42), I19 (= I44), D38 (= D63), M39 (≠ R64), D64 (= D86), V65 (= V87), N91 (= N113), A92 (= A114), G93 (= G115), M141 (≠ L165), A142 (= A166), S143 (= S167), Y156 (= Y180), K160 (= K184), P186 (= P210), G187 (= G211), V189 (≠ T213), T191 (= T215), L193 (≠ M217)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ T117), S143 (= S167), N145 (≠ A169), K153 (≠ R177), Y156 (= Y180), Q197 (= Q221)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
40% identity, 45% coverage: 32:274/546 of query aligns to 2:248/250 of 2cfcA
- active site: G13 (= G43), S142 (= S167), Y155 (= Y180), K159 (= K184)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ L174), R152 (= R177), Y155 (= Y180), W195 (≠ D220), R196 (≠ Q221)
- binding nicotinamide-adenine-dinucleotide: G9 (= G39), S12 (≠ D42), G13 (= G43), N14 (≠ I44), D33 (= D63), L34 (≠ R64), A59 (≠ M85), D60 (= D86), V61 (= V87), N87 (= N113), A88 (= A114), G89 (= G115), I140 (≠ L165), P185 (= P210), G186 (= G211), M187 (≠ Y212), I188 (≠ T213), T190 (= T215), P191 (≠ Q216), M192 (= M217), T193 (≠ V218)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
40% identity, 45% coverage: 32:274/546 of query aligns to 2:248/250 of Q56840
- SGN 12:14 (≠ DGI 42:44) binding
- D33 (= D63) binding
- DV 60:61 (= DV 86:87) binding
- N87 (= N113) binding
- S142 (= S167) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (= R177) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y180) mutation Y->E,F: Loss of activity.
- K159 (= K184) mutation to A: Loss of activity.
- R179 (= R204) mutation to A: Loss of activity.
- IETPM 188:192 (≠ TRTQM 213:217) binding
- WR 195:196 (≠ DQ 220:221) binding
- R196 (≠ Q221) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ D228) mutation to A: Slight decrease in catalytic efficiency.
- R209 (= R235) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
36% identity, 44% coverage: 33:274/546 of query aligns to 7:258/260 of 6zzqA
- active site: G17 (= G43), S142 (= S167), Y155 (= Y180)
- binding acetoacetic acid: Q94 (≠ T117), S142 (= S167), K152 (≠ R177), Y155 (= Y180), Q196 (= Q221)
- binding nicotinamide-adenine-dinucleotide: G13 (= G39), S16 (≠ D42), G17 (= G43), I18 (= I44), D37 (= D63), M38 (≠ R64), D63 (= D86), V64 (= V87), N90 (= N113), A91 (= A114), G92 (= G115), M140 (≠ L165), A141 (= A166), S142 (= S167), Y155 (= Y180), K159 (= K184), Y187 (= Y212), V188 (≠ T213), T190 (= T215)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
36% identity, 46% coverage: 26:274/546 of query aligns to 4:251/258 of 4wecA
- active site: G21 (= G43), S143 (= S167), Q154 (≠ R177), Y157 (= Y180), K161 (= K184)
- binding nicotinamide-adenine-dinucleotide: G17 (= G39), A19 (= A41), S20 (≠ D42), G21 (= G43), I22 (= I44), D41 (= D63), I42 (≠ R64), V61 (≠ M85), D62 (= D86), V63 (= V87), N89 (= N113), T141 (≠ L165), Y157 (= Y180), K161 (= K184), P187 (= P210), P189 (≠ Y212), V190 (≠ T213)
4cqmF Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
39% identity, 44% coverage: 33:272/546 of query aligns to 7:236/241 of 4cqmF
- active site: G17 (= G43), S139 (= S167), Q149 (≠ R177), Y152 (= Y180), K156 (= K184)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G39), R16 (≠ D42), G17 (= G43), I18 (= I44), A37 (≠ D63), R38 (= R64), N39 (= N65), D60 (= D86), V61 (= V87), A87 (≠ N113), A88 (= A114), G89 (= G115), V137 (≠ L165), S139 (= S167), Y152 (= Y180), K156 (= K184), V185 (≠ T213), T187 (= T215), M189 (= M217)
Q8N4T8 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit; KAR beta subunit; Carbonyl reductase family member 4; CBR4; Quinone reductase CBR4; Short chain dehydrogenase/reductase family 45C member 1; EC 1.1.1.100; EC 1.6.5.10 from Homo sapiens (Human) (see 4 papers)
39% identity, 44% coverage: 33:272/546 of query aligns to 3:232/237 of Q8N4T8
- G9 (= G39) mutation to S: Unable to restore growth of an OAR1-deficient yeast mutant.
- SRGI 11:14 (≠ ADGI 41:44) binding
- R12 (≠ D42) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant.
- R34 (= R64) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Strongly reduces NADPH-dependent reductase activity with acetoacetyl-CoA and 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- RN 34:35 (= RN 64:65) binding
- D56 (= D86) binding
- L70 (= L100) to M: in dbSNP:rs2877380
- AAG 83:85 (≠ NAG 113:115) binding
- S135 (= S167) mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- Y148 (= Y180) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- K152 (= K184) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant. Abolishes NADPH-dependent reductase activity with acetoacetyl-CoA. Strongly reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- R168 (≠ A200) mutation to E: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- K169 (= K201) mutation to E: Unable to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- VHT 181:183 (≠ TRT 213:215) binding
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 45% coverage: 31:275/546 of query aligns to 4:247/247 of 4jroC
- active site: G16 (= G43), S142 (= S167), Q152 (≠ R177), Y155 (= Y180), K159 (= K184)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G39), S14 (≠ A41), R15 (≠ D42), G16 (= G43), I17 (= I44), N35 (≠ A62), Y36 (≠ D63), N37 (≠ R64), G38 (≠ N65), S39 (≠ V66), N63 (≠ D86), V64 (= V87), N90 (= N113), A91 (= A114), I93 (≠ V116), I113 (= I138), S142 (= S167), Y155 (= Y180), K159 (= K184), P185 (= P210), I188 (≠ T213), T190 (= T215)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 46% coverage: 26:274/546 of query aligns to 1:253/255 of 5itvA
- active site: G18 (= G43), S141 (= S167), Y154 (= Y180), K158 (= K184)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G39), S17 (≠ D42), G18 (= G43), I19 (= I44), D38 (= D63), I39 (≠ R64), T61 (≠ M85), I63 (≠ V87), N89 (= N113), G91 (= G115), T139 (≠ L165), S141 (= S167), Y154 (= Y180), K158 (= K184), P184 (= P210), G185 (= G211), I186 (≠ Y212), I187 (≠ T213)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
36% identity, 46% coverage: 26:276/546 of query aligns to 7:259/267 of 3ay6B
- active site: G24 (= G43), S151 (= S167), Y164 (= Y180), K168 (= K184)
- binding beta-D-glucopyranose: E102 (≠ T117), S151 (= S167), H153 (≠ A169), W158 (≠ L174), Y164 (= Y180), N202 (≠ V218), K205 (≠ Q221)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G39), T23 (≠ D42), G24 (= G43), L25 (≠ I44), Y45 (≠ R64), D71 (= D86), V72 (= V87), N98 (= N113), A99 (= A114), G100 (= G115), V101 (= V116), M149 (≠ L165), S151 (= S167), Y164 (= Y180), K168 (= K184), P194 (= P210), G195 (= G211), M197 (≠ T213), T199 (= T215), P200 (≠ Q216), I201 (≠ M217), N202 (≠ V218)
P50162 Tropinone reductase 1; Tropine dehydrogenase; Tropinone reductase I; TR-I; EC 1.1.1.206 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
36% identity, 44% coverage: 300:537/546 of query aligns to 26:271/273 of P50162
- S158 (= S427) binding
- Y171 (= Y440) active site, Proton acceptor
Sites not aligning to the query:
1ae1B Tropinone reductase-i complex with NADP (see paper)
36% identity, 44% coverage: 300:537/546 of query aligns to 11:256/258 of 1ae1B
- active site: G17 (= G306), S143 (= S427), V153 (≠ R437), Y156 (= Y440), K160 (= K444)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G302), S15 (≠ G304), K16 (≠ R305), G17 (= G306), I18 (= I307), S37 (≠ E326), R38 (= R327), C62 (≠ T351), D63 (= D352), L64 (≠ V353), N91 (= N376), A92 (= A377), S143 (= S427), Y156 (= Y440), K160 (= K444), P186 (= P470), I189 (= I473), T191 (= T475), L193 (≠ A477), V194 (= V478)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
34% identity, 45% coverage: 31:276/546 of query aligns to 4:244/244 of 7krmC
- active site: G18 (= G43), S140 (= S167), Y155 (= Y180)
- binding nicotinamide-adenine-dinucleotide: G12 (= G39), S15 (≠ D42), G18 (= G43), I19 (= I44), D38 (= D63), L39 (≠ R64), A60 (≠ M85), N61 (≠ D86), V62 (= V87), N88 (= N113), V111 (≠ I138), S140 (= S167), Y155 (= Y180), K159 (= K184), I188 (≠ T213), T190 (= T215)
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
36% identity, 44% coverage: 36:277/546 of query aligns to 15:257/257 of 5fffA
- active site: K206 (≠ A224)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (≠ T117), H158 (≠ R177)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G39), T20 (≠ A41), G22 (= G43), I23 (= I44), R43 (= R64), C67 (≠ M85), D68 (= D86), V69 (= V87), N96 (= N113), I146 (≠ L165), Y161 (= Y180), K165 (= K184), P191 (= P210), A193 (≠ Y212), I194 (≠ T213), T196 (= T215), G198 (≠ M217), T199 (≠ V218)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
36% identity, 44% coverage: 36:277/546 of query aligns to 15:257/257 of 5ff9B
- active site: K206 (≠ A224)
- binding 4-(2-aminoethyl)phenol: Y100 (≠ T117), I155 (≠ L174), H158 (≠ R177)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G39), T20 (≠ A41), K21 (≠ D42), I23 (= I44), S42 (≠ D63), R43 (= R64), C67 (≠ M85), D68 (= D86), V69 (= V87), N96 (= N113), I146 (≠ L165), S148 (= S167), Y161 (= Y180), K165 (= K184), P191 (= P210), A193 (≠ Y212), I194 (≠ T213), T196 (= T215), G198 (≠ M217), T199 (≠ V218)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
36% identity, 44% coverage: 36:277/546 of query aligns to 15:257/257 of A0A1A9TAK5
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
41% identity, 44% coverage: 37:276/546 of query aligns to 16:254/254 of 3lqfA
- active site: G22 (= G43), S144 (= S167), Y159 (= Y180), K163 (= K184)
- binding meso-erythritol: N151 (≠ L174), Y159 (= Y180), Y191 (= Y212), T197 (≠ V218), M200 (≠ Q221)
- binding nicotinamide-adenine-dinucleotide: G18 (= G39), S21 (≠ D42), G22 (= G43), I23 (= I44), D42 (= D63), R43 (= R64), D66 (= D86), V67 (= V87), S92 (≠ N113), L142 (= L165), S144 (= S167), K163 (= K184), P189 (= P210), V192 (≠ T213), T194 (= T215), M196 (= M217), T197 (≠ V218)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
41% identity, 44% coverage: 37:276/546 of query aligns to 16:254/254 of 2wsbA
- active site: G22 (= G43), S144 (= S167), Y159 (= Y180), K163 (= K184)
- binding nicotinamide-adenine-dinucleotide: G18 (= G39), S21 (≠ D42), G22 (= G43), I23 (= I44), D42 (= D63), R43 (= R64), D66 (= D86), V67 (= V87), S92 (≠ N113), A93 (= A114), L142 (= L165), S144 (= S167), Y159 (= Y180), K163 (= K184), P189 (= P210), V192 (≠ T213), T194 (= T215), M196 (= M217), T197 (≠ V218)
- binding n-propanol: S144 (= S167), M145 (≠ G168), N151 (≠ L174), N151 (≠ L174), Y159 (= Y180), Y159 (= Y180), Y191 (= Y212)
Query Sequence
>CCNA_01892 FitnessBrowser__Caulo:CCNA_01892
MARGGALLGFREGRHPRRPHETEYAMTSKAQSRVVLVTGGADGIGWAACQRFARAGDQVL
VADRNVERARERADSLGPDHHAIAMDVSSEAQIREGFEQLHREFGRLDVLVNNAGVTDPQ
PTATLDQTAEEVARLQAINVTGAFLAAREAGRLMIEQGHGAIINLASGAGLVALAKRTSY
SASKAAVISLTRTLACEWAAKGVRVNAVLPGYTRTQMVQDQIDAGLLDPSIVLSRIPLGR
MGEPEEMAEGAFFLASDAASYVVGATLVVDGGYTVYGGSGPASTTPAPSPLAPSPRVSAI
TGGGRGIGRCVVDLFHAAGDRLLVIERDAEGAKALAEALGDEHIVVQADITDVAAVEAAF
AQAQARWGRLDVLINNAGAADVFKPSLEQTAQDFTSVYDLNFSGPLATAKAAARLMSQGG
VIVNLGSIAGLGALPQRNAYCAAKAAVTMMSRSLACEWASAGIRVNTVAPGYIETPAVLA
LKSAGRAQFDKIRRRAPIGRLGDPMEVARTIAFLASPAASYVAGATLTVDGGWTAFGDAG
DASDIL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory