SitesBLAST
Comparing CCNA_01927 FitnessBrowser__Caulo:CCNA_01927 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
44% identity, 96% coverage: 11:267/267 of query aligns to 10:257/257 of 6slbAAA
- active site: Q64 (≠ A66), F69 (≠ G71), L80 (= L90), N84 (= N95), A108 (≠ V119), S111 (= S122), A130 (= A141), F131 (= F142), L136 (= L147), P138 (= P149), D139 (= D150), A224 (≠ H234), G234 (= G244)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (= R60), A62 (≠ S64), Q64 (≠ A66), D65 (≠ N67), L66 (= L68), Y76 (≠ A86), A108 (≠ V119), F131 (= F142), D139 (= D150)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
42% identity, 96% coverage: 11:267/267 of query aligns to 7:245/245 of 6slaAAA
- active site: Q61 (≠ A66), L68 (≠ V80), N72 (= N95), A96 (≠ V119), S99 (= S122), A118 (= A141), F119 (= F142), L124 (= L147), P126 (= P149), N127 (≠ D150), A212 (≠ H234), G222 (= G244)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (= L25), A59 (≠ S64), Q61 (≠ A66), D62 (≠ N67), L63 (= L68), L68 (≠ V80), Y71 (= Y94), A94 (= A117), G95 (= G118), A96 (≠ V119), F119 (= F142), I122 (= I145), L124 (= L147), N127 (≠ D150), F234 (= F256), K237 (= K259)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
35% identity, 100% coverage: 1:267/267 of query aligns to 1:259/259 of 5zaiC
- active site: A65 (= A66), F70 (≠ G71), S82 (≠ E91), R86 (≠ N95), G110 (≠ V119), E113 (≠ S122), P132 (≠ A141), E133 (≠ F142), I138 (≠ L147), P140 (= P149), G141 (≠ D150), A226 (≠ H234), F236 (≠ G244)
- binding coenzyme a: K24 (≠ T24), L25 (= L25), A63 (≠ S64), G64 (= G65), A65 (= A66), D66 (≠ N67), I67 (≠ L68), P132 (≠ A141), R166 (≠ K175), F248 (= F256), K251 (= K259)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
33% identity, 98% coverage: 3:264/267 of query aligns to 2:249/250 of 3q0gD
- active site: A64 (= A66), M69 (≠ G71), T75 (≠ E77), F79 (≠ D81), G103 (≠ V119), E106 (≠ S122), P125 (≠ A141), E126 (≠ F142), V131 (≠ L147), P133 (= P149), G134 (≠ D150), L219 (≠ H234), F229 (≠ G244)
- binding Butyryl Coenzyme A: F225 (≠ Q240), F241 (= F256)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
32% identity, 99% coverage: 1:264/267 of query aligns to 1:254/255 of 3q0jC
- active site: A65 (= A66), M70 (≠ E77), T80 (≠ G87), F84 (≠ E91), G108 (≠ V119), E111 (≠ S122), P130 (≠ A141), E131 (≠ F142), V136 (≠ L147), P138 (= P149), G139 (≠ D150), L224 (≠ H234), F234 (≠ G244)
- binding acetoacetyl-coenzyme a: Q23 (≠ T23), A24 (≠ T24), L25 (= L25), A27 (= A27), A63 (≠ S64), G64 (= G65), A65 (= A66), D66 (≠ N67), I67 (≠ L68), K68 (≠ S69), M70 (≠ E77), F84 (≠ E91), G107 (= G118), G108 (≠ V119), E111 (≠ S122), P130 (≠ A141), E131 (≠ F142), P138 (= P149), G139 (≠ D150), M140 (≠ G151)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 99% coverage: 1:264/267 of query aligns to 1:254/255 of 3q0gC
- active site: A65 (= A66), M70 (≠ E77), T80 (≠ G87), F84 (≠ E91), G108 (≠ V119), E111 (≠ S122), P130 (≠ A141), E131 (≠ F142), V136 (≠ L147), P138 (= P149), G139 (≠ D150), L224 (≠ H234), F234 (≠ G244)
- binding coenzyme a: L25 (= L25), A63 (≠ S64), I67 (≠ L68), K68 (≠ S69), Y104 (≠ P115), P130 (≠ A141), E131 (≠ F142), L134 (≠ I145)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
32% identity, 99% coverage: 3:267/267 of query aligns to 2:256/256 of 3h81A
- active site: A64 (= A66), M69 (≠ E77), T79 (≠ G87), F83 (≠ E91), G107 (≠ V119), E110 (≠ S122), P129 (≠ A141), E130 (≠ F142), V135 (≠ L147), P137 (= P149), G138 (≠ D150), L223 (≠ H234), F233 (≠ G244)
- binding calcium ion: F233 (≠ G244), Q238 (≠ F249)
5dufA Crystal structure of m. Tuberculosis echa6 bound to ligand gsk729a (see paper)
33% identity, 98% coverage: 6:266/267 of query aligns to 4:244/245 of 5dufA
- active site: A62 (= A66), D67 (≠ G71), P74 (= P84), I78 (≠ S88), A102 (≠ V119), Q105 (≠ S122), P124 (≠ A141), T125 (≠ F142), L130 (= L147), L132 (≠ P149), D133 (= D150), P212 (≠ T230), W222 (≠ G244)
- binding (5R,7S)-5-(4-ethylphenyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxylic acid: L77 (≠ G87), I78 (≠ S88), H81 (≠ E91), D85 (≠ N95), Q105 (≠ S122), D133 (= D150), W135 (≠ G152)
5ducA Crystal structure of m. Tuberculosis echa6 bound to ligand gsk951a (see paper)
33% identity, 98% coverage: 6:266/267 of query aligns to 3:243/244 of 5ducA
- active site: A61 (= A66), D66 (≠ G71), P73 (= P84), I77 (≠ S88), A101 (≠ V119), Q104 (≠ S122), P123 (≠ A141), T124 (≠ F142), L129 (= L147), L131 (≠ P149), D132 (= D150), P211 (≠ T230), W221 (≠ G244)
- binding (5R,7S)-N-(1,3-benzodioxol-5-ylmethyl)-5-(4-ethylphenyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L76 (≠ G87), H80 (≠ E91), D84 (≠ N95), Q104 (≠ S122), D132 (= D150), W134 (≠ G152), F217 (≠ Q240)
5du4A Crystal structure of m. Tuberculosis echa6 bound to ligand gsk366a (see paper)
33% identity, 98% coverage: 6:266/267 of query aligns to 3:243/244 of 5du4A
- active site: A61 (= A66), D66 (≠ G71), P73 (= P84), I77 (≠ S88), A101 (≠ V119), Q104 (≠ S122), P123 (≠ A141), T124 (≠ F142), L129 (= L147), L131 (≠ P149), D132 (= D150), P211 (≠ T230), W221 (≠ G244)
- binding (5R,7S)-5-(4-ethylphenyl)-N-(4-methoxybenzyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L76 (≠ G87), I77 (≠ S88), H80 (≠ E91), D84 (≠ N95), Q104 (≠ S122), D132 (= D150), W134 (≠ G152)
5dtwA Crystal structure of m. Tuberculosis echa6 bound to c20-coa (see paper)
33% identity, 98% coverage: 6:266/267 of query aligns to 3:243/244 of 5dtwA
- active site: A61 (= A66), D66 (≠ G71), P73 (= P84), I77 (≠ S88), A101 (≠ V119), Q104 (≠ S122), P123 (≠ A141), T124 (≠ F142), L129 (= L147), L131 (≠ P149), D132 (= D150), P211 (≠ T230), W221 (≠ G244)
- binding Arachinoyl-CoA: R18 (≠ D21), E20 (≠ T23), R21 (≠ T24), R21 (≠ T24), R22 (≠ L25), A24 (= A27), A59 (≠ S64), A61 (= A66), D62 (≠ N67), L63 (= L68), H80 (≠ E91), D84 (≠ N95), G100 (= G118), A101 (≠ V119), Y127 (≠ I145), W134 (≠ G152)
5du6A Crystal structure of m. Tuberculosis echa6 bound to ligand gsk059a. (see paper)
32% identity, 98% coverage: 6:266/267 of query aligns to 3:241/242 of 5du6A
- active site: A61 (= A66), P71 (= P84), I75 (≠ S88), A99 (≠ V119), Q102 (≠ S122), P121 (≠ A141), T122 (≠ F142), L127 (= L147), L129 (≠ P149), D130 (= D150), P209 (≠ T230), W219 (≠ G244)
- binding (5R,7R)-5-(4-ethylphenyl)-N-(4-fluorobenzyl)-7-methyl-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L74 (≠ G87), D82 (≠ N95), D130 (= D150), W132 (≠ G152), A207 (≠ D228), K212 (≠ R237), F215 (≠ Q240)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
32% identity, 99% coverage: 5:267/267 of query aligns to 6:261/261 of 5jbxB
- active site: A67 (= A66), R72 (≠ D85), L84 (= L97), R88 (≠ L101), G112 (≠ V119), E115 (≠ S122), T134 (≠ A141), E135 (≠ F142), I140 (≠ L147), P142 (= P149), G143 (≠ D150), A228 (≠ H234), L238 (≠ A243)
- binding coenzyme a: S24 (≠ T23), R25 (≠ T24), R26 (≠ L25), A28 (= A27), A65 (≠ S64), D68 (≠ N67), L69 (= L68), K70 (= K83), L110 (≠ A117), G111 (= G118), T134 (≠ A141), E135 (≠ F142), L138 (≠ I145), R168 (≠ K175)
Q9P4U9 Enoyl-CoA hydratase AKT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 from Alternaria alternata (Alternaria rot fungus) (Torula alternata) (see paper)
32% identity, 95% coverage: 12:265/267 of query aligns to 23:269/296 of Q9P4U9
Sites not aligning to the query:
- 294:296 Peroxisomal targeting signal type 1
Q9Y232 Chromodomain Y-like protein; CDY-like; Crotonyl-CoA hydratase; EC 4.2.1.- from Homo sapiens (Human) (see 5 papers)
36% identity, 70% coverage: 3:189/267 of query aligns to 341:522/598 of Q9Y232
- S521 (≠ N188) mutation to A: Abolishes CoA-binding and ability to inhibit histone crotonylation.
Sites not aligning to the query:
- 2 T → A: in dbSNP:rs3812179
- 9 S → P: in dbSNP:rs3812178
- 48 V → A: in dbSNP:rs13196069
- 60 A → G: in dbSNP:rs28360500
- 61:309 Interaction with EZH2
- 135 modified: N6,N6,N6-trimethyllysine; by EHMT2; alternate; modified: N6,N6-dimethyllysine; by EHMT2; alternate; modified: N6-methyllysine; by EHMT2; alternate
- 205 S→A: No impact on recruitment to DNA double strand breaks.
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
32% identity, 96% coverage: 11:267/267 of query aligns to 14:260/260 of 2hw5C
- active site: A68 (= A66), M73 (≠ A78), S83 (= S88), L87 (≠ T92), G111 (≠ V119), E114 (≠ S122), P133 (≠ A141), E134 (≠ F142), T139 (≠ L147), P141 (= P149), G142 (≠ D150), K227 (≠ H234), F237 (≠ G244)
- binding crotonyl coenzyme a: K26 (≠ T23), A27 (≠ T24), L28 (= L25), A30 (= A27), K62 (≠ R60), I70 (≠ L68), F109 (≠ A117)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
32% identity, 94% coverage: 14:265/267 of query aligns to 16:252/254 of 2dubA
- active site: A67 (= A66), M72 (≠ D85), S82 (≠ N95), G105 (≠ V119), E108 (≠ S122), P127 (≠ A141), E128 (≠ F142), T133 (≠ L147), P135 (= P149), G136 (≠ D150), K221 (≠ H234), F231 (≠ G244)
- binding octanoyl-coenzyme a: K25 (≠ T23), A26 (≠ T24), L27 (= L25), A29 (= A27), A65 (≠ S64), A67 (= A66), D68 (≠ N67), I69 (≠ L68), K70 (= K83), G105 (≠ V119), E108 (≠ S122), P127 (≠ A141), E128 (≠ F142), G136 (≠ D150), A137 (≠ G151)
1jxzB Structure of the h90q mutant of 4-chlorobenzoyl-coenzyme a dehalogenase complexed with 4-hydroxybenzoyl-coenzyme a (product) (see paper)
33% identity, 81% coverage: 3:219/267 of query aligns to 2:214/269 of 1jxzB
- active site: C61 (= C63), F64 (≠ A66), I69 (≠ A78), A86 (≠ E91), Q90 (≠ N95), G113 (= G118), G114 (≠ V119), G117 (≠ S122), A136 (= A141), W137 (≠ F142), I142 (≠ L147), N144 (≠ P149), D145 (= D150)
- binding 4-hydroxybenzoyl coenzyme a: R22 (≠ T23), H23 (≠ T24), R24 (≠ L25), A62 (≠ S64), F64 (≠ A66), Y65 (≠ N67), L66 (= L68), R67 (= R76), W89 (≠ Y94), G113 (= G118), A136 (= A141), W137 (≠ F142), I142 (≠ L147), D145 (= D150), T146 (≠ G151)
- binding calcium ion: G49 (≠ R51), L202 (= L207), A203 (= A208), A205 (≠ G210), T207 (≠ A212), Q210 (≠ G215)
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
32% identity, 94% coverage: 14:265/267 of query aligns to 17:256/258 of 1mj3A
- active site: A68 (= A66), M73 (≠ A78), S83 (= S88), L85 (= L90), G109 (≠ V119), E112 (≠ S122), P131 (≠ A141), E132 (≠ F142), T137 (≠ L147), P139 (= P149), G140 (≠ D150), K225 (= K238), F235 (≠ G244)
- binding hexanoyl-coenzyme a: K26 (≠ T23), A27 (≠ T24), L28 (= L25), A30 (= A27), A66 (≠ S64), G67 (= G65), A68 (= A66), D69 (≠ N67), I70 (≠ L68), G109 (≠ V119), P131 (≠ A141), E132 (≠ F142), L135 (≠ I145), G140 (≠ D150)
1nzyB 4-chlorobenzoyl coenzyme a dehalogenase from pseudomonas sp. Strain cbs-3 (see paper)
33% identity, 81% coverage: 3:219/267 of query aligns to 2:214/269 of 1nzyB
- active site: C61 (= C63), F64 (≠ A66), I69 (≠ A78), A86 (≠ E91), H90 (≠ N95), G114 (≠ V119), G117 (≠ S122), A136 (= A141), W137 (≠ F142), I142 (≠ L147), N144 (≠ P149), D145 (= D150)
- binding 4-hydroxybenzoyl coenzyme a: R22 (≠ T23), H23 (≠ T24), R24 (≠ L25), A62 (≠ S64), F64 (≠ A66), Y65 (≠ N67), L66 (= L68), R67 (= R76), W89 (≠ Y94), G113 (= G118), G114 (≠ V119), A136 (= A141), W137 (≠ F142), D145 (= D150), T146 (≠ G151)
- binding calcium ion: G49 (≠ R51), L202 (= L207), A203 (= A208), A205 (≠ G210), T207 (≠ A212), Q210 (≠ G215)
- binding phosphate ion: E57 (≠ G59), N108 (= N113), K188 (≠ D193), R192 (≠ M197)
Sites not aligning to the query:
Query Sequence
>CCNA_01927 FitnessBrowser__Caulo:CCNA_01927
MDYQKIRVSTQDGVATVTLADPTTLNAASPEVARELHHAFSSIAAGKIEARAVILTGEGR
GFCSGANLSGGGAAGREADVDGKPDAGSALETVYNPLMTLLRDFPLPIVTAVNGPAAGVG
CSIALMGDLIVAAESAYFLQAFRRIGLVPDGGSTYLLPRLIGKARAMEMMLLGDKIPAAT
ALQWGLVNRCVPDAELMVTAHALALELAKGPAALGVIRKLVWDSLDSDWTGQLHAERKAQ
KIAGKTEDFIEGVTAFLQKRAAVFKGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory