SitesBLAST
Comparing CCNA_01959 FitnessBrowser__Caulo:CCNA_01959 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2cjfA Type ii dehydroquinase inhibitor complex (see paper)
57% identity, 92% coverage: 4:138/146 of query aligns to 7:142/149 of 2cjfA
- binding (1s,4s,5s)-1,4,5-trihydroxy-3-[3-(phenylthio)phenyl]cyclohex-2-ene-1-carboxylic acid: N15 (= N12), L16 (= L13), L18 (= L15), L19 (= L16), R22 (= R19), Y27 (= Y24), N78 (= N75), A80 (= A77), A81 (≠ G78), H84 (= H81), D91 (= D88), T95 (= T92), H105 (= H101), I106 (≠ L102), S107 (= S103), R116 (= R112)
2bt4A Type ii dehydroquinase inhibitor complex (see paper)
57% identity, 92% coverage: 4:138/146 of query aligns to 7:142/149 of 2bt4A
- binding (1s,3r,4r,5s)-1,3,4-trihydroxy-5-(3-phenoxypropyl)cyclohexanecarboxylic acid: P14 (= P11), N15 (= N12), L16 (= L13), L18 (= L15), L19 (= L16), R22 (= R19), Y27 (= Y24), N78 (= N75), A80 (= A77), A81 (≠ G78), H84 (= H81), H105 (= H101), I106 (≠ L102), S107 (= S103), I109 (≠ P105), R116 (= R112)
1gu1A Crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with 2,3-anhydro-quinic acid (see paper)
57% identity, 92% coverage: 4:138/146 of query aligns to 7:142/149 of 1gu1A
- active site: P14 (= P11), N15 (= N12), R22 (= R19), Y27 (= Y24), N78 (= N75), A81 (≠ G78), E103 (= E99), H105 (= H101), R112 (= R108)
- binding 2,3 -anhydro-quinic acid: Y27 (= Y24), N78 (= N75), A80 (= A77), A81 (≠ G78), H84 (= H81), H105 (= H101), I106 (≠ L102), S107 (= S103), I109 (≠ P105), R116 (= R112)
- binding glycerol: P14 (= P11), N15 (= N12), L16 (= L13), L18 (= L15), L19 (= L16), Y27 (= Y24)
P15474 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
57% identity, 92% coverage: 4:138/146 of query aligns to 9:144/157 of P15474
- R24 (= R19) mutation to A: Reduces kcat 30000-fold. Reduces KM for 3-dehydroquinate 6-fold.; mutation to K: Reduces kcat 2700-fold. Reduces KM for 3-dehydroquinate 4-fold.; mutation to Q: Reduces kcat 3100-fold. Reduces KM for 3-dehydroquinate 8-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1v1jA Crystal structure of type ii dehydroquintae dehydratase from streptomyces coelicolor in complex with 3-fluoro (see paper)
57% identity, 92% coverage: 4:138/146 of query aligns to 8:143/150 of 1v1jA
- active site: P15 (= P11), N16 (= N12), R23 (= R19), Y28 (= Y24), N79 (= N75), A82 (≠ G78), E104 (= E99), H106 (= H101), R113 (= R108)
- binding 2-anhydro-3-fluoro-quinic acid: Y28 (= Y24), N79 (= N75), A81 (= A77), A82 (≠ G78), H85 (= H81), H106 (= H101), I107 (≠ L102), S108 (= S103), I110 (≠ P105), R113 (= R108), R117 (= R112)
1gtzA Structure of streptomyces coelicolor type ii dehydroquinase r23a mutant in complex with dehydroshikimate (see paper)
57% identity, 92% coverage: 4:138/146 of query aligns to 7:142/149 of 1gtzA
- active site: P14 (= P11), N15 (= N12), A22 (≠ R19), Y27 (= Y24), N78 (= N75), A81 (≠ G78), E103 (= E99), H105 (= H101), R112 (= R108)
- binding 3-dehydroshikimate: Y27 (= Y24), N78 (= N75), A80 (= A77), A81 (≠ G78), H84 (= H81), H105 (= H101), I106 (≠ L102), S107 (= S103), I109 (≠ P105), R116 (= R112)
3n8kM Type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 12:144/151 of 3n8kM
- active site: P18 (= P11), N19 (= N12), N82 (= N75), G85 (= G78), E106 (= E99), H108 (= H101), R115 (= R108)
- binding 2,6-dioxo-1,2,3,6-tetrahydropyridine-4-carboxylic acid: R26 (= R19), Y31 (= Y24), N82 (= N75), G84 (≠ A77), G85 (= G78), H88 (= H81), H108 (= H101), I109 (≠ L102), S110 (= S103), R115 (= R108), R119 (= R112)
4b6pA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 3:135/142 of 4b6pA
- active site: P9 (= P11), N10 (= N12), R17 (= R19), Y22 (= Y24), N73 (= N75), G76 (= G78), E97 (= E99), H99 (= H101), R106 (= R108)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N10 (= N12), L11 (= L13), R13 (≠ L15), L14 (= L16), R17 (= R19), Y22 (= Y24), N73 (= N75), G75 (≠ A77), G76 (= G78), H79 (= H81), H99 (= H101), I100 (≠ L102), S101 (= S103), V103 (≠ P105), R106 (= R108), R110 (= R112)
4cl0A Structure of the mycobacterium tuberculosis type ii dehydroquinase inhibited by a 3-dehydroquinic acid derivative
48% identity, 91% coverage: 5:137/146 of query aligns to 3:135/140 of 4cl0A
- active site: P9 (= P11), N10 (= N12), R17 (= R19), Y22 (= Y24), N73 (= N75), G76 (= G78), E97 (= E99), H99 (= H101), R106 (= R108)
- binding (2r)-2-methyl-3-dehydroquinic acid: L11 (= L13), R17 (= R19), Y22 (= Y24), N73 (= N75), G75 (≠ A77), G76 (= G78), H79 (= H81), H99 (= H101), I100 (≠ L102), S101 (= S103), V103 (≠ P105), R110 (= R112)
4b6oA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 4:136/142 of 4b6oA
- active site: P10 (= P11), N11 (= N12), R18 (= R19), Y23 (= Y24), N74 (= N75), G77 (= G78), E98 (= E99), H100 (= H101), R107 (= R108)
- binding (1R,2S,4S,5R)-2-(4-methoxyphenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N11 (= N12), R14 (≠ L15), Y23 (= Y24), N74 (= N75), G76 (≠ A77), G77 (= G78), H80 (= H81), H100 (= H101), I101 (≠ L102), S102 (= S103), V104 (≠ P105), R111 (= R112)
3n59C Type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 4:136/142 of 3n59C
- active site: P10 (= P11), N11 (= N12), R18 (= R19), N74 (= N75), G77 (= G78), E98 (= E99), H100 (= H101), R107 (= R108)
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: R18 (= R19), Y23 (= Y24), N74 (= N75), G76 (≠ A77), G77 (= G78), H80 (= H81), H100 (= H101), I101 (≠ L102), S102 (= S103), R107 (= R108), R111 (= R112)
3n76A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with compound 5 (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 4:136/143 of 3n76A
- active site: P10 (= P11), N11 (= N12), R18 (= R19), Y23 (= Y24), N74 (= N75), G77 (= G78), E98 (= E99), H100 (= H101), R107 (= R108)
- binding (1s,3r,4r,5s)-1,3,4-trihydroxy-5-(3-phenoxypropyl)cyclohexanecarboxylic acid: N11 (= N12), R14 (≠ L15), L15 (= L16), R18 (= R19), E19 (= E20), Y23 (= Y24), N74 (= N75), G76 (≠ A77), G77 (= G78), H80 (= H81), H100 (= H101), I101 (≠ L102), S102 (= S103), V104 (≠ P105), R111 (= R112)
4kiwA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49e [5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid] (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 3:135/141 of 4kiwA
- active site: P9 (= P11), N10 (= N12), R17 (= R19), Y22 (= Y24), N73 (= N75), G76 (= G78), E97 (= E99), H99 (= H101), R106 (= R108)
- binding 5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid: N10 (= N12), L11 (= L13), R13 (≠ L15), L14 (= L16), Y22 (= Y24), N73 (= N75), G75 (≠ A77), G76 (= G78), H79 (= H81), D86 (= D88), E90 (≠ T92), H99 (= H101), I100 (≠ L102), S101 (= S103), V103 (≠ P105), R106 (= R108), R110 (= R112)
4kiuA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49d [5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid] (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 3:135/141 of 4kiuA
- active site: P9 (= P11), N10 (= N12), R17 (= R19), Y22 (= Y24), N73 (= N75), G76 (= G78), E97 (= E99), H99 (= H101), R106 (= R108)
- binding 5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid: P9 (= P11), N10 (= N12), L11 (= L13), R13 (≠ L15), L14 (= L16), E18 (= E20), Y22 (= Y24), N73 (= N75), G75 (≠ A77), G76 (= G78), H79 (= H81), H99 (= H101), I100 (≠ L102), S101 (= S103), V103 (≠ P105), R110 (= R112)
4ciwA Crystal structure of mycobacterium tuberculosis type 2 dehydroquinase in complex with (1r,4r,5r)-1,4,5-trihydroxy-3-(2-hydroxy) ethylcyclohex-2-ene-1-carboxylic acid (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 3:135/141 of 4ciwA
- active site: P9 (= P11), N10 (= N12), R17 (= R19), Y22 (= Y24), N73 (= N75), G76 (= G78), E97 (= E99), H99 (= H101), R106 (= R108)
- binding (1R,4R,5R)-1,4,5-trihydroxy-3-(2-hydroxy)ethylcyclohex-2-ene-1-carboxylic acid: N10 (= N12), L11 (= L13), Y22 (= Y24), N73 (= N75), G75 (≠ A77), G76 (= G78), H79 (= H81), H99 (= H101), I100 (≠ L102), S101 (= S103), V103 (≠ P105), R110 (= R112)
3n87A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 3 (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 3:135/141 of 3n87A
- active site: P9 (= P11), N10 (= N12), R17 (= R19), Y22 (= Y24), N73 (= N75), G76 (= G78), E97 (= E99), H99 (= H101), R106 (= R108)
- binding (1R,4R,5R)-1,4,5-trihydroxy-3-[3-(phenylcarbonyl)phenyl]cyclohex-2-ene-1-carboxylic acid: P9 (= P11), N10 (= N12), L11 (= L13), R17 (= R19), E18 (= E20), Y22 (= Y24), N73 (= N75), G75 (≠ A77), G76 (= G78), H79 (= H81), D86 (= D88), E90 (≠ T92), H99 (= H101), I100 (≠ L102), S101 (= S103), R110 (= R112)
3n86A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 4 (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 3:135/141 of 3n86A
- active site: P9 (= P11), N10 (= N12), R17 (= R19), Y22 (= Y24), N73 (= N75), G76 (= G78), E97 (= E99), H99 (= H101), R106 (= R108)
- binding (1R,5R)-1,5-dihydroxy-4-oxo-3-[3-oxo-3-(phenylamino)propyl]cyclohex-2-ene-1-carboxylic acid: P9 (= P11), N10 (= N12), L11 (= L13), R13 (≠ L15), R17 (= R19), E18 (= E20), Y22 (= Y24), N73 (= N75), G75 (≠ A77), G76 (= G78), H79 (= H81), D86 (= D88), E90 (≠ T92), H99 (= H101), I100 (≠ L102), S101 (= S103), V103 (≠ P105), R110 (= R112)
2xb8A Structure of mycobacterium tuberculosis type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3- dehydroquinic acid (see paper)
48% identity, 91% coverage: 5:137/146 of query aligns to 3:135/141 of 2xb8A
- active site: P9 (= P11), N10 (= N12), R17 (= R19), Y22 (= Y24), N73 (= N75), G76 (= G78), E97 (= E99), H99 (= H101), R106 (= R108)
- binding (1r,2r,4s,5r)-1,4,5-trihydroxy-2-(4-methoxybenzyl)-3-oxocyclohexanecarboxylic acid: N10 (= N12), L11 (= L13), R13 (≠ L15), L14 (= L16), Y22 (= Y24), N73 (= N75), G75 (≠ A77), G76 (= G78), H79 (= H81), H99 (= H101), I100 (≠ L102), S101 (= S103), V103 (≠ P105), R110 (= R112)
5ydbA Crystal structure of the complex of type ii dehydroquinate dehydratase from acinetobacter baumannii with dehydroquinic acid at 1.76 angstrom resolution
47% identity, 97% coverage: 5:145/146 of query aligns to 3:144/145 of 5ydbA
- active site: P9 (= P11), N10 (= N12), R17 (= R19), Y22 (= Y24), N74 (= N75), A77 (≠ G78), E98 (= E99), H100 (= H101), R107 (= R108)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: N74 (= N75), A76 (= A77), A77 (≠ G78), H80 (= H81), H100 (= H101), L101 (= L102), S102 (= S103), V104 (≠ P105), R107 (= R108), R111 (= R112)
5b6pA Structure of the dodecameric type-ii dehydrogenate dehydratase from acinetobacter baumannii at 2.00 a resolution (see paper)
47% identity, 97% coverage: 5:145/146 of query aligns to 3:144/145 of 5b6pA
- active site: P9 (= P11), N10 (= N12), R17 (= R19), Y22 (= Y24), N74 (= N75), A77 (≠ G78), E98 (= E99), H100 (= H101), R107 (= R108)
- binding sulfate ion: N74 (= N75), A76 (= A77), H100 (= H101), L101 (= L102), S102 (= S103)
Query Sequence
>CCNA_01959 FitnessBrowser__Caulo:CCNA_01959
MVKPIHVLSGPNLNLLGTREPEIYGKDTLDDVRTRCEARAASRGVSVVFRQSNHEGVLID
WVHEARESASALVINPAGYGHTSIALLDALKTLSIPVIECHLSNPAAREEFRRHTYVSLA
ATGIVSGFGAASYELAIEAAFGLIRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory