Comparing CCNA_01974 FitnessBrowser__Caulo:CCNA_01974 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
59% identity, 93% coverage: 1:185/198 of query aligns to 1:185/187 of P00903
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
50% identity, 98% coverage: 2:196/198 of query aligns to 75:275/276 of Q42565
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
50% identity, 94% coverage: 3:188/198 of query aligns to 7:191/673 of 8hx8A
Sites not aligning to the query:
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
44% identity, 96% coverage: 2:191/198 of query aligns to 4:193/193 of P00900
Sites not aligning to the query:
1i7qB Anthranilate synthase from s. Marcescens (see paper)
44% identity, 96% coverage: 2:191/198 of query aligns to 3:192/192 of 1i7qB
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
41% identity, 94% coverage: 3:188/198 of query aligns to 6:148/632 of 8hx9A
Sites not aligning to the query:
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
35% identity, 96% coverage: 1:191/198 of query aligns to 1:181/183 of 7yc6A
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
35% identity, 97% coverage: 1:193/198 of query aligns to 1:189/475 of 2ywcA
Sites not aligning to the query:
Q9LVW7 Carbamoyl phosphate synthase small chain, chloroplastic; Carbamoyl phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 83% coverage: 14:178/198 of query aligns to 254:410/430 of Q9LVW7
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
31% identity, 98% coverage: 2:195/198 of query aligns to 178:362/2225 of P27708
Sites not aligning to the query:
Q18990 Multifunctional protein pyr-1; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Caenorhabditis elegans (see 3 papers)
33% identity, 64% coverage: 47:173/198 of query aligns to 221:344/2198 of Q18990
Sites not aligning to the query:
P0A6F1 Carbamoyl phosphate synthase small chain; Carbamoyl phosphate synthetase glutamine chain; EC 6.3.5.5 from Escherichia coli (strain K12) (see paper)
29% identity, 81% coverage: 35:195/198 of query aligns to 224:381/382 of P0A6F1
Sites not aligning to the query:
1ce8B Carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp (see paper)
29% identity, 77% coverage: 35:187/198 of query aligns to 223:372/379 of 1ce8B
Sites not aligning to the query:
1gpmA Escherichia coli gmp synthetase complexed with amp and pyrophosphate (see paper)
27% identity, 93% coverage: 2:185/198 of query aligns to 8:196/501 of 1gpmA
Sites not aligning to the query:
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
30% identity, 86% coverage: 11:181/198 of query aligns to 185:349/2225 of P08955
Sites not aligning to the query:
1c3oB Crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine (see paper)
28% identity, 77% coverage: 35:187/198 of query aligns to 223:372/379 of 1c3oB
Sites not aligning to the query:
P05990 Multifunctional protein r; Protein rudimentary; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Drosophila melanogaster (Fruit fly) (see 2 papers)
31% identity, 63% coverage: 46:170/198 of query aligns to 234:355/2224 of P05990
Sites not aligning to the query:
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
32% identity, 59% coverage: 74:189/198 of query aligns to 99:212/693 of P49915
Sites not aligning to the query:
5tw7F Crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
25% identity, 96% coverage: 2:191/198 of query aligns to 6:195/490 of 5tw7F
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
33% identity, 59% coverage: 74:189/198 of query aligns to 77:187/658 of 2vxoB
Sites not aligning to the query:
>CCNA_01974 FitnessBrowser__Caulo:CCNA_01974
MILVIDNYDSFTYNLVHYLNELGADTAVYRNDALSVTEALGLKPAAVLLSPGPKAPDQAG
ICLPLLEAAPADLPILGVCLGHQAIGQAFGGEVIRAKAVMHGKVSKVRHNDKGIFKGLPN
PFTATRYHSLAVRREDLPADLEVTAWTDDGEIMGVQHKTRPIFGVQFHPESIATEGGHQM
LANFMDLAGVKRDAAIWV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory