SitesBLAST
Comparing CCNA_01982 FitnessBrowser__Caulo:CCNA_01982 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
41% identity, 97% coverage: 9:466/470 of query aligns to 3:461/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
41% identity, 97% coverage: 9:466/470 of query aligns to 3:461/471 of P04805
- C98 (= C104) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ M106) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ D131) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ P133) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ G135) mutation to Q: No change in activity or in zinc content.
- H131 (≠ L137) mutation to Q: No change in activity or in zinc content.
- H132 (≠ S138) mutation to Q: No change in activity or in zinc content.
- C138 (≠ H141) mutation to S: No change in activity or in zinc content.
- S239 (= S242) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
45% identity, 77% coverage: 9:371/470 of query aligns to 3:354/380 of 4g6zA
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
38% identity, 98% coverage: 9:467/470 of query aligns to 2:468/468 of 1g59A
- binding : D44 (= D51), R45 (= R52), A46 (≠ E53), R47 (= R54), P109 (≠ I108), V145 (= V142), R163 (≠ K160), V166 (= V163), E172 (= E169), V177 (= V174), K180 (≠ R177), S181 (≠ A178), D182 (= D179), E207 (≠ D204), E208 (≠ D205), R237 (≠ H234), K241 (≠ G238), T242 (≠ A239), K243 (= K240), M273 (≠ L270), G274 (= G271), E282 (= E278), S299 (≠ V295), L300 (≠ K296), P303 (≠ A299), V304 (≠ R300), K309 (= K305), W312 (≠ H308), R319 (= R315), P357 (≠ E354), R358 (≠ G355), R417 (≠ K416), K426 (≠ G425), L427 (≠ F426), Q432 (≠ P431), R435 (= R434), L442 (≠ A441), E443 (≠ Q442), T444 (≠ A443), P445 (= P444), G446 (≠ D445), L447 (= L446), F448 (≠ N447)
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
38% identity, 98% coverage: 9:467/470 of query aligns to 2:468/468 of 2cv2A
- active site: K246 (= K243)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R12), A7 (= A14), S9 (= S16), G17 (= G24), I21 (≠ T28), E41 (= E48), Y187 (= Y184), R205 (= R202), A206 (≠ G203), E208 (≠ D205), W209 (≠ H206), L235 (= L232), L236 (≠ I233)
- binding : S9 (= S16), T43 (= T50), D44 (= D51), R47 (= R54), V145 (= V142), R163 (≠ K160), Y168 (≠ F165), E172 (= E169), V177 (= V174), K180 (≠ R177), S181 (≠ A178), Y187 (= Y184), E207 (≠ D204), E208 (≠ D205), W209 (≠ H206), V211 (≠ N208), R237 (≠ H234), K241 (≠ G238), L272 (≠ R269), M273 (≠ L270), G274 (= G271), E282 (= E278), S299 (≠ V295), P303 (≠ A299), V304 (≠ R300), K309 (= K305), W312 (≠ H308), R319 (= R315), P357 (≠ E354), R358 (≠ G355), R417 (≠ K416), Q432 (≠ P431), R435 (= R434), L442 (≠ A441), E443 (≠ Q442), T444 (≠ A443), G446 (≠ D445), L447 (= L446), F448 (≠ N447)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
38% identity, 98% coverage: 9:467/470 of query aligns to 2:468/468 of 2cv1A
- active site: K246 (= K243)
- binding adenosine-5'-triphosphate: P8 (= P15), S9 (= S16), G17 (= G24), T18 (≠ G25), I21 (≠ T28), R47 (= R54), A206 (≠ G203), W209 (≠ H206), L235 (= L232), L236 (≠ I233)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R12), A7 (= A14), E41 (= E48), Y187 (= Y184), R205 (= R202), W209 (≠ H206)
- binding : S9 (= S16), E41 (= E48), T43 (= T50), D44 (= D51), R47 (= R54), V145 (= V142), R163 (≠ K160), V166 (= V163), E172 (= E169), V177 (= V174), K180 (≠ R177), S181 (≠ A178), Y187 (= Y184), E207 (≠ D204), E208 (≠ D205), W209 (≠ H206), V211 (≠ N208), R237 (≠ H234), K241 (≠ G238), K243 (= K240), M273 (≠ L270), G274 (= G271), S276 (≠ G273), E282 (= E278), S299 (≠ V295), P303 (≠ A299), V304 (≠ R300), K309 (= K305), W312 (≠ H308), R319 (= R315), P357 (≠ E354), R358 (≠ G355), R417 (≠ K416), L427 (≠ F426), Q432 (≠ P431), R435 (= R434), L442 (≠ A441), E443 (≠ Q442), T444 (≠ A443), G446 (≠ D445), L447 (= L446), F448 (≠ N447)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
38% identity, 98% coverage: 9:467/470 of query aligns to 2:468/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
38% identity, 98% coverage: 9:467/470 of query aligns to 2:468/468 of 1n78A
- active site: K246 (= K243)
- binding glutamol-amp: R5 (= R12), A7 (= A14), P8 (= P15), S9 (= S16), G17 (= G24), T18 (≠ G25), I21 (≠ T28), E41 (= E48), Y187 (= Y184), N191 (≠ V188), R205 (= R202), A206 (≠ G203), E208 (≠ D205), W209 (≠ H206), L235 (= L232), L236 (≠ I233)
- binding : S9 (= S16), T43 (= T50), D44 (= D51), R47 (= R54), V145 (= V142), R163 (≠ K160), V166 (= V163), Y168 (≠ F165), E172 (= E169), V177 (= V174), K180 (≠ R177), S181 (≠ A178), Y187 (= Y184), E207 (≠ D204), E208 (≠ D205), W209 (≠ H206), L210 (= L207), V211 (≠ N208), R237 (≠ H234), K241 (≠ G238), M273 (≠ L270), G274 (= G271), E282 (= E278), R297 (≠ D293), P303 (≠ A299), V304 (≠ R300), K309 (= K305), W312 (≠ H308), R319 (= R315), P357 (≠ E354), R358 (≠ G355), R417 (≠ K416), L427 (≠ F426), Q432 (≠ P431), R435 (= R434), L442 (≠ A441), E443 (≠ Q442), T444 (≠ A443), G446 (≠ D445), L447 (= L446), F448 (≠ N447)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
38% identity, 98% coverage: 9:467/470 of query aligns to 2:468/468 of 1j09A
- active site: K246 (= K243)
- binding adenosine-5'-triphosphate: H15 (= H22), E208 (≠ D205), L235 (= L232), L236 (≠ I233), K243 (= K240), I244 (≠ L241), S245 (= S242), K246 (= K243), R247 (= R244)
- binding glutamic acid: R5 (= R12), A7 (= A14), S9 (= S16), E41 (= E48), Y187 (= Y184), N191 (≠ V188), R205 (= R202), W209 (≠ H206)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
38% identity, 98% coverage: 9:467/470 of query aligns to 2:468/468 of P27000
- R358 (≠ G355) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
39% identity, 93% coverage: 9:446/470 of query aligns to 3:457/485 of Q8DLI5
- R6 (= R12) binding
- Y192 (= Y184) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
39% identity, 93% coverage: 9:446/470 of query aligns to 2:456/484 of 2cfoA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
35% identity, 97% coverage: 9:466/470 of query aligns to 103:559/564 of 3al0C
- active site: S110 (= S16), K335 (= K243)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R12), A108 (= A14), P109 (= P15), G118 (= G24), T122 (= T28), E142 (= E48), Y276 (= Y184), R294 (= R202), G295 (= G203), D297 (= D205), H298 (= H206), L324 (= L232), I325 (= I233), L333 (= L241)
- binding : T144 (= T50), D145 (= D51), R148 (= R54), Y208 (≠ M106), P213 (≠ K117), K252 (= K160), M255 (≠ V163), I266 (≠ V174), K269 (≠ R177), S270 (≠ A178), Y276 (= Y184), D297 (= D205), H298 (= H206), L299 (= L207), S300 (≠ N208), N301 (= N209), K304 (≠ R212), R330 (≠ G238), P332 (≠ K240), G363 (= G271), W364 (= W272), R365 (≠ G273), E370 (= E278), S387 (≠ V295), K389 (≠ A297), V391 (≠ A299), I392 (≠ R300), K397 (= K305), W400 (≠ H308), R407 (= R315), E446 (= E354), K447 (≠ G355), Q453 (≠ E361), I457 (≠ H365), R509 (≠ A419), K520 (vs. gap), Q524 (≠ P431), R527 (= R434), V535 (≠ Q442), T536 (≠ A443), G538 (≠ D445), L539 (= L446)
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
31% identity, 96% coverage: 11:462/470 of query aligns to 4:475/485 of 4griB
- active site: S9 (= S16), K253 (= K243)
- binding glutamic acid: R5 (= R12), A7 (= A14), S9 (= S16), E41 (= E48), Y194 (= Y184), R212 (= R202), W216 (≠ H206)
- binding zinc ion: C105 (= C104), C107 (≠ M106), Y128 (vs. gap), C132 (≠ I125)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
33% identity, 97% coverage: 9:466/470 of query aligns to 3:498/502 of 6brlA
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
32% identity, 98% coverage: 7:466/470 of query aligns to 2:466/488 of 8vc5A
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
36% identity, 52% coverage: 5:250/470 of query aligns to 12:248/308 of P27305
- E55 (= E48) binding
- Y182 (= Y184) binding
- R200 (= R202) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
36% identity, 51% coverage: 7:244/470 of query aligns to 2:230/290 of 4a91A
- active site: S11 (= S16), K229 (= K243)
- binding glutamic acid: R7 (= R12), A9 (= A14), S11 (= S16), E43 (= E48), Y170 (= Y184), R188 (= R202), L192 (≠ H206)
- binding zinc ion: C99 (= C104), C101 (≠ V113), Y113 (≠ I125), C117 (≠ W129)
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
32% identity, 61% coverage: 9:296/470 of query aligns to 11:314/455 of 3aiiA
P46655 Glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; (c)ERS; GluRS; P85; EC 6.1.1.17 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 56% coverage: 9:271/470 of query aligns to 202:484/708 of P46655
Sites not aligning to the query:
- 148 R→A: Abolishes interaction with ARC1.
Query Sequence
>CCNA_01982 FitnessBrowser__Caulo:CCNA_01982
MSNPTPTGVVTRFAPSPTGFLHIGGARTALFNWLYARHTGGKFLIRVEDTDRERSTEAAV
AAIFEGLDWLGLKSDDEVIFQHTRAPRHVEVVHELLAKGRAYRCWMSIEELEVAREKARA
EGRAIRSPWRDAPEGDLSAPHVIRFKGPLDGETLVNDLVKGPVTFKNIELDDLVLLRADG
APTYNLAVVVDDHDMGVTHVIRGDDHLNNAARQTLIYQAMDWAVPAFAHIPLIHGPDGAK
LSKRHGAQAVGEFADLGYIPEGMRNYLARLGWGHGDDEVFTDEQAISWFDVADVVKAPAR
LDWAKLNHINAQHLRKADDARLTALALAAAETRGEPLPADAAERIARTVPEVKEGAKTIL
ELVDHCAFALKTRPLALEEKTQKQLTEETVERLKRLRDQLAAAPDFDAATLETVLKSFAE
SEGVGFGKFGPALRGVLTGGAQAPDLNKTMAALSRDEAIGRLDDALAPRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory