Comparing CCNA_01990 FitnessBrowser__Caulo:CCNA_01990 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0CD76 UDP-3-O-acylglucosamine N-acyltransferase; EC 2.3.1.191 from Chlamydia trachomatis (strain D/UW-3/Cx) (see paper)
32% identity, 86% coverage: 42:331/339 of query aligns to 33:330/354 of P0CD76
2iu8A Chlamydia trachomatis lpxd with 25mm udpglcnac (complex i) (see paper)
32% identity, 86% coverage: 42:331/339 of query aligns to 33:330/346 of 2iu8A
4ihgE Chasing acyl carrier protein through a catalytic cycle of lipid a production (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 5:318/337 of 4ihgE
6p8aA E.Coli lpxd in complex with compound 8.1 (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 4:317/335 of 6p8aA
6p89A E.Coli lpxd in complex with compound 7 (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 4:317/335 of 6p89A
6p88A E.Coli lpxd in complex with compound 6 (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 4:317/335 of 6p88A
6p87A E.Coli lpxd in complex with compound 5 (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 4:317/335 of 6p87A
6p86A E.Coli lpxd in complex with compound 4.1 (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 4:317/335 of 6p86A
6p85A E.Coli lpxd in complex with compound 3 (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 4:317/335 of 6p85A
6p84A E.Coli lpxd in complex with compound 2o (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 4:317/335 of 6p84A
6p83A E.Coli lpxd in complex with compound 1o (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 4:317/335 of 6p83A
P21645 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase; UDP-3-O-(3-OHC14)-GlcN N-acyltransferase; Protein FirA; Rifampicin resistance protein; UDP-3-O-(3-hydroxytetradecanoyl)glucosamine N-acyltransferase; EC 2.3.1.191 from Escherichia coli (strain K12) (see 4 papers)
33% identity, 93% coverage: 15:328/339 of query aligns to 6:319/341 of P21645
Sites not aligning to the query:
4ihhE Chasing acyl carrier protein through a catalytic cycle of lipid a production (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 7:320/340 of 4ihhE
P0A1X4 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase; UDP-3-O-(3-OHC14)-GlcN N-acyltransferase; UDP-3-O-(3-hydroxytetradecanoyl)glucosamine N-acyltransferase; EC 2.3.1.191 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 91% coverage: 21:328/339 of query aligns to 7:319/341 of P0A1X4
4ihfA Chasing acyl carrier protein through a catalytic cycle of lipid a production (see paper)
33% identity, 93% coverage: 15:328/339 of query aligns to 4:317/336 of 4ihfA
3pmoA The structure of lpxd from pseudomonas aeruginosa at 1.3 a resolution (see paper)
30% identity, 98% coverage: 1:331/339 of query aligns to 13:343/357 of 3pmoA
6uecA Pseudomonas aeruginosa lpxd complex structure with ligand (see paper)
31% identity, 92% coverage: 19:331/339 of query aligns to 11:323/337 of 6uecA
4eqyG Crystal structure of acyl-[acyl-carrier-protein]--udp-n- acetylglucosamine o-acyltransferase from burkholderia thailandensis (see paper)
28% identity, 56% coverage: 128:317/339 of query aligns to 2:188/260 of 4eqyG
7ojqA Crystal structure of pseudomonas aeruginosa lpxa in complex with compound 7 (see paper)
29% identity, 59% coverage: 118:316/339 of query aligns to 6:186/255 of 7ojqA
7ojwA Crystal structure of pseudomonas aeruginosa lpxa in complex with compound 93 (see paper)
29% identity, 59% coverage: 118:316/339 of query aligns to 6:187/256 of 7ojwA
>CCNA_01990 FitnessBrowser__Caulo:CCNA_01990
MPDPRFFDSLGPALLSELAQAGAATLADAALGERVITHAAPLDASDAQAITFFSDAKRKD
AAASTRAGACFVRPEHQGFLPPTCAALVTGRPQAAWAAAANRLHAPRRHEAGAPSLHPDA
ALEDGVALAPNVTIGQGASIGRGTRIGPGVVIGPGVVIGRYCRIGANAVIGFAMLGDNVA
ISAGAVIGEAGFGAALGPRGMVDLPQLGRVVIQDNVTLGANSCVDRGAFGDTTIGENTKI
DNLVHVAHNVRIGRNCVLAAYTGVSGSTVVGDGVAFGGKAGVADHLNIGSGASIGAAASV
FKDVPDGETWTGFPARPLKRWLRETAWLSRMAGGRGTRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory