Comparing CCNA_02006 FitnessBrowser__Caulo:CCNA_02006 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
48% identity, 98% coverage: 1:223/228 of query aligns to 1:223/233 of P75957
7mdyC Lolcde nucleotide-bound
49% identity, 96% coverage: 5:223/228 of query aligns to 2:220/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
49% identity, 96% coverage: 5:223/228 of query aligns to 2:220/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
48% identity, 96% coverage: 5:223/228 of query aligns to 4:222/229 of 7v8iD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
49% identity, 90% coverage: 24:228/228 of query aligns to 18:223/223 of 2pclA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
41% identity, 96% coverage: 5:224/228 of query aligns to 1:224/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
41% identity, 96% coverage: 5:224/228 of query aligns to 1:224/230 of 1l2tA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
41% identity, 95% coverage: 5:221/228 of query aligns to 3:218/226 of 5xu1B
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
41% identity, 96% coverage: 4:223/228 of query aligns to 3:221/648 of P75831
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
38% identity, 96% coverage: 5:223/228 of query aligns to 4:221/650 of 5ws4A
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
42% identity, 94% coverage: 11:224/228 of query aligns to 4:216/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
42% identity, 94% coverage: 11:224/228 of query aligns to 4:216/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
42% identity, 94% coverage: 11:224/228 of query aligns to 4:216/218 of 8hd0A
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
36% identity, 96% coverage: 5:223/228 of query aligns to 3:220/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
36% identity, 96% coverage: 5:223/228 of query aligns to 3:220/615 of 5lilA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
42% identity, 91% coverage: 14:221/228 of query aligns to 7:212/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 96% coverage: 5:223/228 of query aligns to 1:219/343 of P30750
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
40% identity, 87% coverage: 25:223/228 of query aligns to 20:217/230 of 6z4wA
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
40% identity, 87% coverage: 25:223/228 of query aligns to 20:217/229 of 6z67B
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 96% coverage: 5:223/228 of query aligns to 2:220/344 of 6cvlD
>CCNA_02006 FitnessBrowser__Caulo:CCNA_02006
MSDPVLALRGLERVYKTEAGDLPVLRGVDLDVYPGEVVGLIGPSGSGKSSLLHSAGLLER
PDAGLVALEGRDCSKLSERARTRIRLGTVGFVYQFHHLLPEFSALENVAMPLTIAGKSRR
EAEARARELLESLGLGHRLNHQPAQMSGGEQQRVAIARALANRPKLLLADEPTGNLDPAT
STAVFQALYQVCREQGVAAVIATHNMELARYMDRVVALKDGHLELQRV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory