Comparing CCNA_02074 FitnessBrowser__Caulo:CCNA_02074 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
6addA The crystal structure of rv2747 from mycobacterium tuberculosis in complex with coa and nlq (see paper)
33% identity, 62% coverage: 43:138/156 of query aligns to 34:125/168 of 6addA
Sites not aligning to the query:
5yo2A The crystal structure of rv2747 from mycobacterium tuberculosis in complex with acetyl coa and l-arginine (see paper)
33% identity, 62% coverage: 43:138/156 of query aligns to 34:125/168 of 5yo2A
Sites not aligning to the query:
5ygeA Arga complexed with acecoa and glutamate (see paper)
35% identity, 59% coverage: 43:134/156 of query aligns to 35:122/169 of 5ygeA
Sites not aligning to the query:
>CCNA_02074 FitnessBrowser__Caulo:CCNA_02074
MPKPQLRIIAGDFEDPRIIALLAHHFATMRSTGPEESCHVMPLGTMRQADLDFFAAWDGD
ALAGFGAVKQLGDGHGEIKSMHTAAAYRGRGVGQAVLDHLSTHARALGLQRLSLETGAGD
FFVPARAMYARNGFQTCDPFGDYKPDPNSVFMTRML
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory