SitesBLAST
Comparing CCNA_02094 FitnessBrowser__Caulo:CCNA_02094 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7bvjA Udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) (see paper)
33% identity, 98% coverage: 5:304/305 of query aligns to 4:308/313 of 7bvjA
- binding (2R,3R)-2,3-bis(oxidanyl)butane-1,4-disulfonic acid: R223 (≠ K225), Y230 (≠ E232), S232 (≠ E234)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), H13 (≠ V14), L14 (≠ F15), F32 (= F35), D33 (= D36), E34 (≠ I37), R38 (= R41), T68 (≠ A71), P69 (= P72)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
28% identity, 91% coverage: 4:280/305 of query aligns to 2:314/336 of 3ec7A
- active site: K97 (= K94), H176 (= H166)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), M12 (≠ V14), I13 (≠ F15), D35 (= D36), I36 (= I37), R40 (= R41), T73 (≠ A70), A74 (= A71), S75 (≠ P72), N76 (≠ A73), H79 (= H76), E96 (= E93), K97 (= K94), M126 (≠ Q122), W271 (≠ F237), Y279 (≠ T246)
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
30% identity, 77% coverage: 5:238/305 of query aligns to 2:254/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ V14), F152 (≠ R146), N154 (≠ G148), D175 (= D162), L176 (= L163), H179 (= H166), E236 (= E221)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G13), F11 (≠ V14), M12 (≠ F15), D33 (= D36), L34 (≠ I37), T70 (≠ A70), T71 (≠ A71), P72 (= P72), N73 (≠ A73), L75 (≠ H75), H76 (= H76), Q79 (≠ P79), E93 (= E93), K94 (= K94), N122 (vs. gap), W161 (≠ L155), H179 (= H166)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
30% identity, 77% coverage: 5:238/305 of query aligns to 2:254/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ V14), N154 (≠ G148), D175 (= D162), H179 (= H166), E236 (= E221)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G11), G10 (= G13), F11 (≠ V14), M12 (≠ F15), D33 (= D36), L34 (≠ I37), T70 (≠ A70), T71 (≠ A71), P72 (= P72), N73 (≠ A73), L75 (≠ H75), H76 (= H76), Q79 (≠ P79), E93 (= E93), K94 (= K94), N122 (vs. gap), W161 (≠ L155)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
30% identity, 77% coverage: 5:238/305 of query aligns to 2:254/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), F11 (≠ V14), M12 (≠ F15), D33 (= D36), L34 (≠ I37), T70 (≠ A70), T71 (≠ A71), P72 (= P72), N73 (≠ A73), L75 (≠ H75), H76 (= H76), Q79 (≠ P79), E93 (= E93), K94 (= K94), N122 (vs. gap), W161 (≠ L155), H179 (= H166)
Sites not aligning to the query:
6o15A Crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with NAD(h) (see paper)
34% identity, 38% coverage: 5:121/305 of query aligns to 2:118/355 of 6o15A
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), Y11 (≠ V14), F12 (= F15), Y32 (≠ F35), D33 (= D36), A67 (= A70), T68 (≠ A71), P69 (= P72), N70 (≠ A73), H73 (= H76), E90 (= E93), K91 (= K94)
Sites not aligning to the query:
3e18A Crystal structure of NAD-binding protein from listeria innocua
30% identity, 66% coverage: 9:209/305 of query aligns to 8:222/348 of 3e18A
- active site: K94 (= K94), H178 (= H166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G13 (≠ V14), M14 (≠ F15), F34 (= F35), D35 (= D36), I36 (= I37), K40 (≠ A42), A70 (= A70), T71 (≠ A71), P72 (= P72), N73 (≠ A73), H76 (= H76), E93 (= E93), K94 (= K94), N122 (≠ E123), W161 (vs. gap), R162 (= R153), H178 (= H166)
7xr9A Crystal structure of dgpa with glucose (see paper)
42% identity, 27% coverage: 50:132/305 of query aligns to 45:129/344 of 7xr9A
Sites not aligning to the query:
6z3cAAA Gfo/Idh/MocA family oxidoreductase (see paper)
33% identity, 39% coverage: 3:121/305 of query aligns to 10:128/379 of 6z3cAAA
- binding nicotinamide-adenine-dinucleotide: G20 (= G13), Y21 (≠ V14), F22 (= F15), L42 (≠ F35), D43 (= D36), P44 (≠ I37), A77 (= A70), T78 (≠ A71), P79 (= P72), N80 (≠ A73), H83 (= H76), E100 (= E93), K101 (= K94)
Sites not aligning to the query:
7xreC Crystal structure of dgpa
43% identity, 23% coverage: 64:132/305 of query aligns to 71:139/363 of 7xreC
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
28% identity, 77% coverage: 64:299/305 of query aligns to 64:317/333 of Q2I8V6
- TTNELH 71:76 (≠ APAVHH 71:76) binding
- EK 93:94 (= EK 93:94) binding
- K94 (= K94) mutation to G: Less than 1% remaining activity.
- N120 (≠ G120) binding
- WR 162:163 (≠ VR 145:146) binding
- D176 (= D162) mutation to A: Less than 1% remaining activity.
- H180 (= H166) mutation to A: Less than 2% remaining activity.
- G206 (≠ T189) mutation to I: No effect.
- Y283 (vs. gap) binding
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 33 S→D: No activity.
- 33:34 binding
- 38 binding
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
30% identity, 57% coverage: 4:176/305 of query aligns to 2:186/337 of 3nt5A
- active site: K97 (= K94), H176 (= H166)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K94), H155 (≠ R146), H176 (= H166)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), G11 (= G13), A12 (≠ V14), I13 (≠ F15), D35 (= D36), V36 (≠ I37), S74 (≠ A71), W75 (≠ P72), G76 (≠ A73), E96 (= E93), K97 (= K94)
Sites not aligning to the query:
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
30% identity, 57% coverage: 4:176/305 of query aligns to 2:186/337 of 3nt4A
- active site: K97 (= K94), H176 (= H166)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ R146), H176 (= H166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G13), A12 (≠ V14), I13 (≠ F15), D35 (= D36), V36 (≠ I37), S74 (≠ A71), W75 (≠ P72), G76 (≠ A73), E96 (= E93), K97 (= K94), H176 (= H166)
Sites not aligning to the query:
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
30% identity, 57% coverage: 4:176/305 of query aligns to 2:186/337 of 3nt2B
- active site: K97 (= K94), H176 (= H166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G11), G11 (= G13), A12 (≠ V14), D35 (= D36), V36 (≠ I37), S74 (≠ A71), W75 (≠ P72), A78 (≠ H75), K97 (= K94)
Sites not aligning to the query:
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
30% identity, 57% coverage: 4:176/305 of query aligns to 2:186/337 of 3nt2A
- active site: K97 (= K94), H176 (= H166)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), G11 (= G13), A12 (≠ V14), I13 (≠ F15), D35 (= D36), V36 (≠ I37), S74 (≠ A71), W75 (≠ P72), G76 (≠ A73), A78 (≠ H75), H79 (= H76), E96 (= E93), K97 (= K94), H176 (= H166)
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
26% identity, 97% coverage: 5:299/305 of query aligns to 2:317/333 of 4koaA
- active site: K94 (= K94), H180 (= H166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), A9 (= A12), S10 (≠ G13), T11 (≠ V14), I12 (≠ F15), S33 (≠ D36), S34 (≠ I37), R38 (= R41), T71 (≠ A71), N73 (≠ A73), H76 (= H76), K94 (= K94), Q160 (≠ E143)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
28% identity, 77% coverage: 64:299/305 of query aligns to 63:316/332 of 2glxA
- active site: K93 (= K94), H179 (= H166)
- binding acetate ion: K93 (= K94), H179 (= H166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S69 (≠ A70), T70 (≠ A71), N72 (≠ A73), H75 (= H76), E92 (= E93), K93 (= K94), H121 (≠ Q122), W161 (≠ V145), R162 (= R146), Y282 (vs. gap)
Sites not aligning to the query:
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
30% identity, 57% coverage: 4:176/305 of query aligns to 2:186/337 of 4l8vA
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
26% identity, 74% coverage: 10:236/305 of query aligns to 3:258/335 of 5a05A
- active site: K100 (= K94), Y185 (≠ H166)
- binding beta-D-glucopyranose: K100 (= K94), F159 (≠ V145), D181 (= D162), Y185 (≠ H166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G16), L10 (vs. gap), G11 (= G17), Y12 (= Y18), Y13 (≠ H19), S35 (≠ D36), G36 (≠ I37), T37 (≠ D38), K40 (≠ R41), Y58 (= Y54), I76 (≠ A70), T77 (≠ A71), P78 (= P72), N79 (≠ A73), L81 (≠ H75), H82 (= H76), E99 (= E93), K100 (= K94), R128 (≠ Q122), W167 (≠ R153), R168 (≠ N154), Y185 (≠ H166)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
26% identity, 74% coverage: 10:236/305 of query aligns to 3:258/335 of 5a04A
- active site: K100 (= K94), Y185 (≠ H166)
- binding beta-D-glucopyranose: K100 (= K94), F159 (≠ V145), R168 (≠ N154), D181 (= D162), Y185 (≠ H166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (vs. gap), G11 (= G17), Y12 (= Y18), Y13 (≠ H19), S35 (≠ D36), G36 (≠ I37), T37 (≠ D38), K40 (≠ R41), Y58 (= Y54), I76 (≠ A70), T77 (≠ A71), P78 (= P72), N79 (≠ A73), L81 (≠ H75), H82 (= H76), E99 (= E93), K100 (= K94), R128 (≠ Q122), W167 (≠ R153), R168 (≠ N154), Y185 (≠ H166)
Sites not aligning to the query:
Query Sequence
>CCNA_02094 FitnessBrowser__Caulo:CCNA_02094
MTQTLKAGVVGAGVFGGYHAKKYVELDGVTLVGVFDIDLARAKALAEPLGAQGYDDMDAF
LAAVDVVTVAAPAVHHAAPALAALKAGKPVYSEKPLAVSPDDADKMVAAAAKAGVPLACG
HQERVVFQAMGLLDIPEQPLRLEAVRRGTPSDRNLDVSVVLDLMIHDIDLALALCDGQPI
AVEGEGAITRSTSLDWVKAEATFDNGFTAVFDSSRVAEARERTMKVVYPSGEVEIDFLQR
TFRNTTPYPLIENFTETPAGKDPLGLSVAGFLAAVRGQASRPVVTGEEAARALDLALAVE
QSVEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory