Comparing CCNA_02131 FitnessBrowser__Caulo:CCNA_02131 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ut0A Crystal structure of exo-1,3/1,4-beta-glucanase (exop) from pseudoalteromonas sp. Bb1 (see paper)
51% identity, 89% coverage: 50:778/821 of query aligns to 14:759/804 of 3ut0A
3wlpA Crystal structure analysis of plant exohydrolase (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 13:598/602 of 3wlpA
3wljA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 3-deoxy-glucose (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 13:598/602 of 3wljA
1x39A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 13:598/602 of 1x39A
1x38A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 13:598/602 of 1x38A
1lq2A Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 13:598/602 of 1lq2A
1j8vA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 4'-nitrophenyl 3i-thiolaminaritrioside (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 13:598/602 of 1j8vA
1iewA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 2-deoxy-2-fluoro-alpha-d-glucoside (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 13:598/602 of 1iewA
1ievA Crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with cyclohexitol (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 13:598/602 of 1ievA
1ex1A Beta-d-glucan exohydrolase from barley (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 13:598/602 of 1ex1A
6jg1A Crystal structure of barley exohydrolasei wildtype in complex with 4i, 4iii,4v-s-trithiocellohexaose (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 17:602/606 of 6jg1A
6jgaA Crystal structure of barley exohydrolasei w286f in complex with 4'- nitrophenyl thiolaminaribioside (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 17:602/606 of 6jgaA
6jg7A Crystal structure of barley exohydrolasei w286f in complex with methyl 2-thio-beta-sophoroside (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 17:602/606 of 6jg7A
6jg2A Crystal structure of barley exohydrolasei wildtype in complex with 4'- nitrophenyl thiolaminaribioside (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 15:599/603 of 6jg2A
6jg6A Crystal structure of barley exohydrolasei w286a mutant in complex with methyl 6-thio-beta-gentiobioside (see paper)
42% identity, 71% coverage: 54:638/821 of query aligns to 17:602/606 of 6jg6A
5m6gA Crystal structure glucan 1,4-beta-glucosidase from saccharopolyspora erythraea
46% identity, 71% coverage: 57:639/821 of query aligns to 15:578/579 of 5m6gA
5jp0A Bacteroides ovatus xyloglucan pul gh3b with bound glucose (see paper)
30% identity, 73% coverage: 44:640/821 of query aligns to 1:623/745 of 5jp0A
Sites not aligning to the query:
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
32% identity, 72% coverage: 52:641/821 of query aligns to 1:620/742 of 3u48B
Sites not aligning to the query:
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
32% identity, 71% coverage: 54:640/821 of query aligns to 4:618/733 of 5tf0A
Sites not aligning to the query:
6r5vA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with xylotriose (see paper)
32% identity, 72% coverage: 54:641/821 of query aligns to 4:615/730 of 6r5vA
Sites not aligning to the query:
>CCNA_02131 FitnessBrowser__Caulo:CCNA_02131
MLPRRFAFASALALTIACGSAGVVLAQTPPNATANPAVWPMSASPAAITDAKTEAFIAQL
MSRMTVEEKVAQTIQADGASITPEELKKYRLGSVLVGGNSAPDGNDRASPQRWIEWIRAF
RAAALDKRGDRQEIPIIFGVDAVHGHNNVVGATIFPHNVGLGAAHEPDLIRRIGEVTAKE
MAATGADWTFGPTVAVPRDSRWGRAYEGYGENPEIVKAYSGPMTLGLQGALEAGKPLAAG
RVAGSAKHFLADGGTENGRDQGDAKISEADLVRLHNAGYPPAIEAGILSVMVSFSSWNGV
KHTGNKSLLTDVLKERMGFEGFVVGDWNAHGQVEGCSNTSCAQAYNAGMDMMMAPDSWKG
LYDNTLAQVKAGQIPMARIDDAVRRILRVKVKAGLFEDKRPLEGKLELLGAPEHRAVARE
AVRKSLVLLKNEGVLPLKSSARVLVAGDGADDIGKASGGWTLTWQGTGNKNSDFPHGQSI
YAGVAEAVKAGGGSAELSVSGDFKQKPDVAIVVFGENPYAEFQGDITSIEYQAGDKRDLA
LLKKLKAAGIPVVSVFLSGRPLWTNPELNASDAFVAAWLPGSEGGGVADVLVGDKAGKPR
HDFQGKLSFSWPKRADQEPINVGDPGYDPLFAYGYGLSYAKPGKVAKLSEDPGVASAAAN
VDRYFVDGRTPPPWMMNASGAASLKTVDAGAQENARQATWSGEGLGVVGVMGSPVDLSRQ
TTGDMAVMLRYRVEAAPTKPVSMSVTCGESCRATVDVTSTLSGAKTGEWRTAKIKLSCFL
AKGADMTQISSPFALTTAGALTLSFTEIRLASNEGDATCPN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory