Comparing CCNA_02173 FitnessBrowser__Caulo:CCNA_02173 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
40% identity, 93% coverage: 14:245/249 of query aligns to 5:245/650 of 5ws4A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
42% identity, 88% coverage: 14:232/249 of query aligns to 2:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
42% identity, 88% coverage: 14:232/249 of query aligns to 2:223/230 of 1l2tA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
42% identity, 88% coverage: 17:235/249 of query aligns to 7:223/226 of 5xu1B
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
38% identity, 94% coverage: 14:248/249 of query aligns to 4:240/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
38% identity, 94% coverage: 14:248/249 of query aligns to 4:240/615 of 5lilA
7mdyC Lolcde nucleotide-bound
41% identity, 88% coverage: 14:232/249 of query aligns to 3:220/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
41% identity, 88% coverage: 14:232/249 of query aligns to 6:223/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
41% identity, 88% coverage: 14:232/249 of query aligns to 3:220/222 of 7arlD
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
41% identity, 91% coverage: 14:240/249 of query aligns to 5:226/648 of P75831
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
40% identity, 88% coverage: 14:232/249 of query aligns to 5:222/229 of 7v8iD
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 86% coverage: 14:227/249 of query aligns to 4:215/330 of P9WQK5
8g4cB Bceabs atpgs high res tm (see paper)
36% identity, 90% coverage: 14:238/249 of query aligns to 4:227/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
35% identity, 90% coverage: 14:238/249 of query aligns to 3:226/245 of 7tchB
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
39% identity, 87% coverage: 24:239/249 of query aligns to 11:223/223 of 2pclA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
40% identity, 83% coverage: 30:235/249 of query aligns to 14:217/240 of 4ymuJ
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
34% identity, 90% coverage: 12:235/249 of query aligns to 2:220/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
34% identity, 90% coverage: 12:235/249 of query aligns to 2:220/229 of 6z67B
3c4jA Abc protein artp in complex with atp-gamma-s
38% identity, 87% coverage: 20:235/249 of query aligns to 6:219/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
38% identity, 87% coverage: 20:235/249 of query aligns to 6:219/242 of 3c41J
>CCNA_02173 FitnessBrowser__Caulo:CCNA_02173
MTRDNAHKRGETALEARGLVKRFKTGRSYIEVLKGIDFDAKHGDVTMVMGPSGSGKSTLV
AALSGLLKPDEGKVSALEAKDLWSLPTGKIDKFRLDHCGFIFQGFNLFPALTAKQQVMTA
LKYQGASPGEQARRAQAALESVGLGPRVNQRPSELSGGEKQRVAIARALAKNPNLIFADE
PTSALDGENGQIVIRLLREAASVRGAAVICVTHDPRLEAYADRVIHIEDGRILDDVRRTP
DANPAPLSH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory