Comparing CCNA_02222 FitnessBrowser__Caulo:CCNA_02222 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
52% identity, 98% coverage: 8:357/358 of query aligns to 2:350/1227 of P13009
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
48% identity, 96% coverage: 14:357/358 of query aligns to 22:365/1265 of Q99707
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
45% identity, 96% coverage: 14:357/358 of query aligns to 6:325/611 of 4cczA
Sites not aligning to the query:
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
34% identity, 89% coverage: 17:334/358 of query aligns to 8:303/841 of 8g3hA
Sites not aligning to the query:
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
29% identity, 86% coverage: 20:326/358 of query aligns to 13:281/560 of 3bofA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
29% identity, 86% coverage: 20:326/358 of query aligns to 13:281/559 of 1q8jA
Sites not aligning to the query:
5dmmA Crystal structure of the homocysteine methyltransferase mmum from escherichia coli, metallated form (see paper)
22% identity, 86% coverage: 19:325/358 of query aligns to 9:281/288 of 5dmmA
>CCNA_02222 FitnessBrowser__Caulo:CCNA_02222
MTDLSIRANRVAALKAAAKERILILDGSWGVMFQKKGLTEADYRAERFAAYNGQMKGNND
ILCLTRPDLVAELHDAYFSAGADISETNTFSGTTIAQADYHLGEQDVWDINLEGAKIGRS
VADRWNAQNPDRPKFIAGSMGPLNVMLSMSSDVNDPGARKVTFDQVYEAYRQQVDALYQG
GVDLFLIETITDTLNCKAAIKAILDWRDEGHEELPIWISGTITDRSGRTLSGQTAEAFWN
SVKHAKPFAVGFNCALGADLMRPHIAEMARIADTLVAAYPNAGLPNAMGQYDEEPHETGH
ALHEWAKDGLVNILGGCCGTTPDHIRHVADEVRGVTPRQIPERPKAMRLAGLEPFELA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory