SitesBLAST
Comparing CCNA_02230 FitnessBrowser__Caulo:CCNA_02230 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
35% identity, 96% coverage: 11:317/319 of query aligns to 6:312/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
35% identity, 96% coverage: 11:317/319 of query aligns to 4:310/311 of 3bazA
- active site: L98 (≠ N105), R230 (= R237), A251 (= A258), D254 (= D261), E259 (= E266), H277 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V81), G149 (= G157), L150 (= L158), G151 (= G159), R152 (≠ H160), I153 (= I161), S172 (≠ A180), R173 (≠ P181), S174 (≠ R182), C201 (≠ A208), P202 (≠ R209), T207 (≠ N214), I228 (≠ V235), G229 (≠ A236), R230 (= R237), D254 (= D261), H277 (= H284), G279 (≠ A286)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
38% identity, 79% coverage: 66:318/319 of query aligns to 57:311/319 of 5v6qB
- active site: L96 (≠ N105), R230 (= R237), D254 (= D261), E259 (= E266), H277 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V81), V100 (= V109), F148 (≠ V156), L150 (= L158), G151 (= G159), R152 (≠ H160), I153 (= I161), T172 (≠ A180), R173 (≠ P181), V201 (≠ A208), P202 (≠ R209), S206 (= S213), T207 (≠ N214), V228 (= V235), G229 (≠ A236), R230 (= R237), H277 (= H284), A279 (= A286)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
38% identity, 79% coverage: 66:318/319 of query aligns to 56:310/319 of 5v7nA
- active site: L95 (≠ N105), R229 (= R237), D253 (= D261), E258 (= E266), H276 (= H284)
- binding 2-keto-D-gluconic acid: G70 (≠ S80), V71 (= V81), G72 (= G82), R229 (= R237), H276 (= H284), S279 (≠ G287), R285 (≠ L293)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V81), V99 (= V109), L149 (= L158), G150 (= G159), R151 (≠ H160), I152 (= I161), T171 (≠ A180), R172 (≠ P181), V200 (≠ A208), P201 (≠ R209), S205 (= S213), T206 (≠ N214), V227 (= V235), G228 (≠ A236), R229 (= R237), H276 (= H284), A278 (= A286)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
38% identity, 79% coverage: 66:318/319 of query aligns to 55:309/317 of 5v7gA
- active site: L94 (≠ N105), R228 (= R237), D252 (= D261), E257 (= E266), H275 (= H284)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V81), V98 (= V109), F146 (≠ V156), L148 (= L158), G149 (= G159), R150 (≠ H160), I151 (= I161), T170 (≠ A180), R171 (≠ P181), V199 (≠ A208), P200 (≠ R209), S204 (= S213), T205 (≠ N214), V226 (= V235), G227 (≠ A236), R228 (= R237), H275 (= H284), A277 (= A286)
- binding oxalate ion: G69 (≠ S80), V70 (= V81), G71 (= G82), R228 (= R237), H275 (= H284)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
38% identity, 79% coverage: 66:318/319 of query aligns to 55:309/318 of 5j23A
- active site: L94 (≠ N105), R228 (= R237), D252 (= D261), E257 (= E266), H275 (= H284)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V81), L148 (= L158), G149 (= G159), R150 (≠ H160), I151 (= I161), T170 (≠ A180), R171 (≠ P181), P200 (≠ R209), S204 (= S213), T205 (≠ N214), R228 (= R237)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
32% identity, 82% coverage: 49:311/319 of query aligns to 44:315/334 of 5aovA
- active site: L100 (≠ N105), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H284)
- binding glyoxylic acid: M52 (≠ A57), L53 (≠ G58), L53 (≠ G58), Y74 (≠ V79), A75 (≠ S80), V76 (= V81), G77 (= G82), R241 (= R237), H288 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V81), T104 (≠ V109), F158 (≠ L158), G159 (= G159), R160 (≠ H160), I161 (= I161), S180 (≠ A180), R181 (= R182), A211 (≠ C207), V212 (≠ A208), P213 (≠ R209), T218 (≠ N214), I239 (≠ V235), A240 (= A236), R241 (= R237), H288 (= H284), G290 (≠ A286)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
32% identity, 82% coverage: 49:311/319 of query aligns to 43:314/332 of 6biiA
- active site: L99 (≠ N105), R240 (= R237), D264 (= D261), E269 (= E266), H287 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V81), T103 (≠ V109), G156 (= G157), F157 (≠ L158), G158 (= G159), R159 (≠ H160), I160 (= I161), A179 (= A180), R180 (vs. gap), S181 (vs. gap), K183 (vs. gap), V211 (≠ A208), P212 (≠ R209), E216 (≠ S213), T217 (≠ N214), V238 (= V235), A239 (= A236), R240 (= R237), D264 (= D261), H287 (= H284), G289 (≠ A286)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
31% identity, 81% coverage: 36:292/319 of query aligns to 28:286/304 of 1wwkA
- active site: S96 (≠ N105), R230 (= R237), D254 (= D261), E259 (= E266), H278 (= H284)
- binding nicotinamide-adenine-dinucleotide: V100 (= V109), G146 (= G157), F147 (≠ L158), G148 (= G159), R149 (≠ H160), I150 (= I161), Y168 (≠ W179), D169 (≠ A180), P170 (= P181), V201 (≠ A208), P202 (≠ R209), T207 (≠ N214), T228 (≠ V235), S229 (≠ A236), D254 (= D261), H278 (= H284), G280 (≠ A286)
6ttbA Crystal structure of NAD-dependent formate dehydrogenase from staphylococcus aureus in complex with NAD
30% identity, 79% coverage: 62:313/319 of query aligns to 68:321/331 of 6ttbA
- binding nicotinamide-adenine-dinucleotide: V87 (= V81), N111 (= N105), V115 (= V109), F162 (≠ V156), G165 (= G159), R166 (≠ H160), I167 (= I161), Y185 (≠ W179), D186 (≠ A180), P187 (= P181), H214 (≠ C207), A215 (= A208), P216 (≠ R209), T221 (≠ N214), T242 (≠ V235), A243 (= A236), R244 (= R237), H292 (= H284), S294 (≠ A286), G295 (= G287)
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
29% identity, 87% coverage: 43:319/319 of query aligns to 25:346/346 of 4zgsA
- active site: S111 (≠ N105), R244 (= R237), D268 (= D261), E273 (= E266), H311 (= H284)
- binding nicotinamide-adenine-dinucleotide: Y110 (≠ L104), G163 (= G159), A164 (≠ H160), I165 (= I161), D184 (≠ A180), C215 (≠ A208), P216 (≠ R209), L218 (≠ D211), S220 (= S213), T221 (≠ N214), S243 (≠ A236), H311 (= H284), F314 (≠ G287)
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
29% identity, 95% coverage: 8:311/319 of query aligns to 2:315/333 of 2dbqA
- active site: L100 (≠ N105), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V81), T104 (≠ V109), L158 (= L158), G159 (= G159), R160 (≠ H160), I161 (= I161), S180 (≠ A180), R181 (≠ P181), T182 (≠ R182), A211 (≠ C207), V212 (≠ A208), P213 (≠ R209), T218 (≠ N214), I239 (≠ V235), A240 (= A236), R241 (= R237), D265 (= D261), H288 (= H284), G290 (≠ A286)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
29% identity, 95% coverage: 8:311/319 of query aligns to 2:315/334 of O58320
8atiA Human ctbp2(31-364) in complex with rai2 peptide(315-322)
33% identity, 71% coverage: 60:286/319 of query aligns to 53:291/330 of 8atiA
- binding nicotinamide-adenine-dinucleotide: S74 (≠ V81), T102 (≠ V109), G155 (= G157), G157 (= G159), R158 (≠ H160), T159 (≠ I161), D178 (≠ A180), P179 (= P181), Y180 (≠ R182), H210 (≠ C207), C211 (≠ A208), N212 (≠ R209), A238 (≠ V235), R240 (= R237), H289 (= H284), A291 (= A286)
Sites not aligning to the query:
4lcjA Ctbp2 in complex with substrate mtob (see paper)
33% identity, 71% coverage: 60:286/319 of query aligns to 53:291/330 of 4lcjA
- active site: A98 (≠ N105), R240 (= R237), D264 (= D261), E269 (= E266), H289 (= H284)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: I72 (≠ V79), G73 (≠ S80), S74 (≠ V81), G75 (= G82), R240 (= R237), H289 (= H284)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ V81), T102 (≠ V109), I154 (≠ V156), G155 (= G157), G157 (= G159), R158 (≠ H160), T159 (≠ I161), D178 (≠ A180), Y180 (≠ R182), H210 (≠ C207), C211 (≠ A208), N212 (≠ R209), N214 (≠ D211), N217 (= N214), A238 (≠ V235), A239 (= A236), R240 (= R237), H289 (= H284)
Sites not aligning to the query:
P56545 C-terminal-binding protein 2; CtBP2 from Homo sapiens (Human)
32% identity, 79% coverage: 60:310/319 of query aligns to 85:347/445 of P56545
2w2lA Crystal structure of the holo forms of rhodotorula graminis d- mandelate dehydrogenase at 2.5a.
32% identity, 79% coverage: 65:316/319 of query aligns to 72:337/346 of 2w2lA
- active site: G113 (≠ N105), R257 (= R237), D281 (= D261), E286 (= E266), H304 (= H284)
- binding nicotinamide-adenine-dinucleotide: T117 (≠ V109), G172 (= G159), A173 (≠ H160), I174 (= I161), D194 (vs. gap), V228 (≠ A208), P229 (≠ R209), T234 (≠ N214), T255 (≠ V235), A256 (= A236), R257 (= R237), H304 (= H284), G306 (≠ A286), G307 (= G287)
1hl3A Ctbp/bars in ternary complex with NAD(h) and pidlskk peptide (see paper)
31% identity, 71% coverage: 60:286/319 of query aligns to 54:292/331 of 1hl3A
- active site: S99 (≠ N105), R241 (= R237), D265 (= D261), E270 (= E266), H290 (= H284)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V109), G158 (= G159), R159 (≠ H160), V160 (≠ I161), D179 (≠ A180), Y181 (≠ R182), H211 (≠ C207), C212 (≠ A208), G213 (≠ R209), N218 (= N214), T239 (≠ V235), A240 (= A236), R241 (= R237), D265 (= D261), H290 (= H284)
Sites not aligning to the query:
1hkuA Ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission (see paper)
31% identity, 71% coverage: 60:286/319 of query aligns to 54:292/331 of 1hkuA
- active site: S99 (≠ N105), R241 (= R237), D265 (= D261), E270 (= E266), H290 (= H284)
- binding nicotinamide-adenine-dinucleotide: S75 (≠ V81), T103 (≠ V109), G156 (= G157), G158 (= G159), R159 (≠ H160), V160 (≠ I161), Y178 (≠ W179), D179 (≠ A180), P180 (= P181), Y181 (≠ R182), C212 (≠ A208), N218 (= N214), T239 (≠ V235), A240 (= A236), R241 (= R237), H290 (= H284)
Sites not aligning to the query:
6v89A Human ctbp1 (28-375) in complex with amp (see paper)
31% identity, 71% coverage: 60:286/319 of query aligns to 54:292/332 of 6v89A
Query Sequence
>CCNA_02230 FitnessBrowser__Caulo:CCNA_02230
MPQTAAEKPQILLSHEMLMPLQPLLEGAYIVHRLWDYPDRMAFLEGPGQSIRAIVHAGEM
ALSRDMLAEMPRLGLIACVSVGYDGVDVPWCKAHGIAVTHSTGLNAADVADHAVGLVLAA
WRGIVEGDQRLRGGHWSHAERMAPRPGLRGRKAGVVGLGHIGEAVAARLKAFDMKVAWWA
PRPKETDYPRADSLMALARDSDVLIVCARPDDSNRHLINKPVIEAVGAQGLIVNVARGSL
IDEDALIQALRAGTLGMAALDVFEQEPTPAARWADVPRTVLTPHTAGATLDSLPAMVSLT
LENLRRYFHGEPLATPVAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory